KEGG   Mycobacterium tuberculosis H37Rv: Rv1412Help
Entry
Rv1412            CDS       T00015                                 

Gene name
ribC
Definition
(RefSeq) riboflavin synthase
  KO
K00793  riboflavin synthase [EC:2.5.1.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00740  Riboflavin metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Rv1412 (ribC)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.9  riboflavin synthase
     Rv1412 (ribC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lum_binding
Motif
Other DBs
NCBI-GeneID: 886690
NCBI-ProteinID: NP_215928
TubercuList: Rv1412
UniProt: P9WK35 I6X166
Position
1588567..1589172
Genome map
AA seq 201 aa AA seqDB search
MFTGIVEERGEVTGREALVDAARLTIRGPMVTADAGHGDSIAVNGVCLTVVDVLPDGQFT
ADVMAETLNRSNLGELRPGSRVNLERAAALGSRLGGHIVQGHVDATGEIVARCPSEHWEV
VRIEMPASVARYVVEKGSITVDGISLTVSGLGAEQRDWFEVSLIPTTRELTTLGSAAVGT
RVNLEVDVVAKYVERLMRSAG
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgttcaccggaattgttgaggaacgcggagaagtgaccgggcgtgaggccctggtcgat
gcggcgcggctgaccatccgcggtccgatggttaccgccgacgccggccacggcgactcg
atcgctgtcaacggcgtgtgtctgacggtcgtcgatgtattgcccgacggccaattcacc
gccgacgtgatggccgagacactgaaccggtccaacctgggtgagctacggcccggcagc
cgggtgaacctggaacgcgccgcggcgctgggcagccggctcggcgggcacatcgtgcag
ggacatgtggacgccaccggtgaaatcgtggcgcgttgtccctccgagcactgggaagtg
gtgcgcatcgagatgccggcttcggtggctcgctatgtcgtcgaaaagggctcgatcacc
gtcgacgggatttctctgacggtctccgggctcggcgccgaacagcgggactggtttgag
gtctcgctgatcccgacgacccgggagctgaccacgctggggtccgctgcggtgggaacc
cgggtgaacctcgaagtcgacgtagtcgcaaagtatgttgagcggttaatgcggagcgcc
ggctga

DBGET integrated database retrieval system