KEGG   Mycobacterium tuberculosis H37Rv: Rv1436Help
Entry
Rv1436            CDS       T00015                                 

Gene name
gap
Definition
(RefSeq) glyceraldehyde 3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtu_M00002  Glycolysis, core module involving three-carbon compounds
mtu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv1436 (gap)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mtu04131]
    Rv1436 (gap)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv1436 (gap)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     Rv1436 (gap)
Membrane trafficking [BR:mtu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Rv1436 (gap)
Exosome [BR:mtu04147]
 Exosomal proteins
  Proteins found in most exosomes
   Rv1436 (gap)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N NAD_binding_3
Motif
Other DBs
NCBI-GeneID: 886632
NCBI-ProteinID: NP_215952
TubercuList: Rv1436
UniProt: P9WN83 I6YAJ8
Position
1613307..1614326
Genome map
AA seq 339 aa AA seqDB search
MTVRVGINGFGRIGRNFYRALLAQQEQGTADVEVVAANDITDNSTLAHLLKFDSILGRLP
CDVGLEGDDTIVVGRAKIKALAVREGPAALPWGDLGVDVVVESTGLFTNAAKAKGHLDAG
AKKVIISAPATDEDITIVLGVNDDKYDGSQNIISNASCTTNCLAPLAKVLDDEFGIVKGL
MTTIHAYTQDQNLQDGPHKDLRRARAAALNIVPTSTGAAKAIGLVMPQLKGKLDGYALRV
PIPTGSVTDLTVDLSTRASVDEINAAFKAAAEGRLKGILKYYDAPIVSSDIVTDPHSSIF
DSGLTKVIDDQAKVVSWYDNEWGYSNRLVDLVTLVGKSL
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtccgagtaggcatcaacgggtttggtcgaatcggacgcaacttctaccgggcc
ttactggcccaacaggagcagggcaccgccgacgtggaggtggtcgccgccaacgacatc
accgacaacagcacgctggcgcatctgctcaaattcgactcgattctgggccggctgcct
tgcgatgtcggcctcgaaggcgacgacaccatcgtcgtcggccgcgcgaaaatcaaggcg
ctcgcggtccgggaggggccggcggcattgccatggggagacctcggcgtcgacgtcgtc
gtcgaatccaccggcctgttcaccaatgcggccaaagccaaaggccacctggacgccggc
gccaagaaggtgatcatctctgcgcccgccaccgacgaggacatcaccatcgtcctggga
gttaacgacgacaagtatgacggcagccagaacatcatctccaatgcgtcgtgcaccacg
aactgccttgcgccgctggccaaagtgctcgacgatgagttcggcatcgtcaagggcctg
atgaccaccatccacgcctacactcaggatcagaacctgcaggacgggccgcacaaggac
ctgcgtcgcgcccgcgccgccgcgctgaacatcgtgccgacctccaccggcgcggccaag
gccatcggcctggtgatgccgcagctaaagggcaagctcgacggttatgcgctgcgggtg
ccgatccccaccggctcggtcaccgaccttacggtcgacttatccacacgggccagtgtc
gatgagatcaacgcggcgttcaaagccgcggccgaaggcaggctcaagggcattctgaag
tactacgacgcgccgatcgtctcgagcgacatcgtcaccgacccgcacagttcgattttc
gactctgggttgaccaaagtcatcgacgaccaggccaaggtggtgtcgtggtacgacaac
gagtggggctactccaaccgcctggttgatctggtcacgctggtcggcaagtcgctctag

DBGET integrated database retrieval system