KEGG   Mycobacterium tuberculosis H37Rv: Rv1437Help
Entry
Rv1437            CDS       T00015                                 

Gene name
pgk
Definition
(RefSeq) phosphoglycerate kinase
  KO
K00927  phosphoglycerate kinase [EC:2.7.2.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtu_M00002  Glycolysis, core module involving three-carbon compounds
mtu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv1437 (pgk)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv1437 (pgk)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.3  phosphoglycerate kinase
     Rv1437 (pgk)
Exosome [BR:mtu04147]
 Exosomal proteins
  Proteins found in most exosomes
   Rv1437 (pgk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGK Phage-Gp8
Motif
Other DBs
NCBI-GeneID: 886636
NCBI-ProteinID: NP_215953
TubercuList: Rv1437
UniProt: P9WID1 I6X185
Position
1614329..1615567
Genome map
AA seq 412 aa AA seqDB search
MSVANLKDLLAEGVSGRGVLVRSDLNVPLDEDGTITDAGRIIASAPTLKALLDADAKVVV
AAHLGRPKDGPDPTLSLAPVAVALGEQLGRHVQLAGDVVGADALARAEGLTGGDILLLEN
IRFDKRETSKNDDDRRALAKQLVELVGTGGVFVSDGFGVVHRKQASVYDIATLLPHYAGT
LVADEMRVLEQLTSSTQRPYAVVLGGSKVSDKLGVIESLATKADSIVIGGGMCFTFLAAQ
GFSVGTSLLEDDMIEVCRGLLETYHDVLRLPVDLVVTEKFAADSPPQTVDVGAVPNGLMG
LDIGPGSIKRFSTLLSNAGTIFWNGPMGVFEFPAYAAGTRGVAEAIVAATGKGAFSVVGG
GDSAAAVRAMNIPEGAFSHISTGGGASLEYLEGKTLPGIEVLSREQPTGGVL
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttgcaaacctcaaggatctactcgccgaaggtgtttcggggcgtggagtgctg
gtgcgctccgatctcaacgttccgctcgacgaggacggcaccattaccgatgcgggccgc
atcatcgcgtcggcgccgacgttgaaggcgttgctcgacgccgacgccaaggtggtggtt
gccgcgcacttgggacgtcccaaggacgggccggacccgacactgtcgctggcgccggtc
gccgtggcgctgggtgagcaactcggccggcacgtccagctggctggagacgttgtcggc
gccgatgcgctggcccgcgccgaggggctcaccggcggcgacatcctgctgctggagaac
atccgcttcgacaaacgcgaaaccagcaagaacgatgacgaccggcgggcactggccaag
cagctggtcgaactggtcggaacgggaggcgttttcgtctccgacggctttggggtggtg
caccgcaagcaagcctcggtctatgacatcgcaaccctgttgccgcactacgccggcacg
ctggtcgccgacgagatgcgggtactggagcagttgaccagctcgacccagcggccctat
gcggtagtgctcggcggatcaaaggtgtccgacaagctgggtgtcatcgagtcgctggcg
accaaggcggacagcattgtgattggcggcggaatgtgcttcacattccttgctgcacag
ggattttcggttggcacatcgctgctggaagacgacatgatcgaagtctgtcgcgggctg
ctggaaacctatcacgacgtgttgcggctgcccgtggatctagtggtcacggagaagttc
gccgccgactcgccgccccagacggtcgacgtcggcgctgtgcccaatggcttgatgggc
ctggatatcgggccgggatcgatcaaacggttcagcacgctgctgtccaacgccgggacc
atcttctggaacgggccgatgggagtattcgagttcccggcttatgcggccggcaccaga
ggcgtcgccgaggcgatcgtcgccgccaccggcaaaggggcgtttagtgtggtcggcggc
ggtgactccgcggccgcagtgcgcgcgatgaacatccccgagggcgccttctcacacata
tccaccggcggcggtgcctcgctggaataccttgagggcaagacgcttcccggcatcgag
gtactgagccgtgagcagccaaccggaggagttttgtga

DBGET integrated database retrieval system