KEGG   Mycobacterium tuberculosis H37Rv: Rv1438Help
Entry
Rv1438            CDS       T00015                                 

Gene name
tpi
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00051  Fructose and mannose metabolism
mtu00562  Inositol phosphate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtu_M00002  Glycolysis, core module involving three-carbon compounds
mtu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv1438 (tpi)
   00051 Fructose and mannose metabolism
    Rv1438 (tpi)
   00562 Inositol phosphate metabolism
    Rv1438 (tpi)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv1438 (tpi)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Rv1438 (tpi)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Rv1438 (tpi)
  Exosomal proteins of bladder cancer cells
   Rv1438 (tpi)
  Exosomal proteins of melanoma cells
   Rv1438 (tpi)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 886628
NCBI-ProteinID: NP_215954
TubercuList: Rv1438
UniProt: P9WG43 I6Y6J3
Structure
PDB: 

Position
1615564..1616349
Genome map
AA seq 261 aa AA seqDB search
MSRKPLIAGNWKMNLNHYEAIALVQKIAFSLPDKYYDRVDVAVIPPFTDLRSVQTLVDGD
KLRLTYGAQDLSPHDSGAYTGDVSGAFLAKLGCSYVVVGHSERRTYHNEDDALVAAKAAT
ALKHGLTPIVCIGEHLDVREAGNHVAHNIEQLRGSLAGLLAEQIGSVVIAYEPVWAIGTG
RVASAADAQEVCAAIRKELASLASPRIADTVRVLYGGSVNAKNVGDIVAQDDVDGGLVGG
ASLDGEHFATLAAIAAGGPLP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcaagccgctgatagccggcaactggaagatgaacctcaaccactacgaggcg
atcgcgctggtgcaaaagatcgcgttctcgttgccggacaagtattacgaccgggttgac
gtcgcggtgatcccgccgtttaccgacctgcgcagcgtgcaaaccctggtcgacggcgac
aagctgcggttgacctatggtgcacaagacttgtcaccacatgactccggtgcctatacg
ggtgacgtcagcggcgcctttctggccaagttggggtgcagttacgttgtcgtcgggcac
tccgagcggcgcacctatcacaacgaggatgacgcgctggtggccgccaaagccgccacc
gcactcaagcatggcttgaccccaatcgtgtgtattggcgagcacctcgacgtccgcgag
gcgggaaatcatgtggcccacaacatcgaacagttgcgtggatcgctggccgggctattg
gccgagcagatcggcagcgtcgtcatcgcctacgaaccggtctgggcgatcggcaccggg
cgggtggccagcgccgccgacgcccaggaggtgtgtgcggcgatccgaaaagagttggcc
tcgttggcctcgccgaggattgccgatacggtgcgggtgctctacggcggctcggtgaac
gccaaaaacgtcggcgacatcgtggcccaggatgacgtcgatggtggcctggtcggcggg
gcgtcgctggacggggagcatttcgcgacgctggccgcgattgcggccggtggtccgttg
ccgtag

DBGET integrated database retrieval system