KEGG   Mycobacterium tuberculosis H37Rv: Rv1445cHelp
Entry
Rv1445c           CDS       T00015                                 

Gene name
devB
Definition
(RefSeq) 6-phosphogluconolactonase
  KO
K01057  6-phosphogluconolactonase [EC:3.1.1.31]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00030  Pentose phosphate pathway
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mtu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv1445c (devB)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.31  6-phosphogluconolactonase
     Rv1445c (devB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucosamine_iso
Motif
Other DBs
NCBI-GeneID: 886617
NCBI-ProteinID: NP_215961
TubercuList: Rv1445c
UniProt: P9WQP5 I6Y6K3
Structure
PDB: 

Position
complement(1623714..1624457)
Genome map
AA seq 247 aa AA seqDB search
MSSSIEIFPDSDILVAAAGKRLVGAIGAAVAARGQALIVLTGGGNGIALLRYLSAQAQQI
EWSKVHLFWGDERYVPEDDDERNLKQARRALLNHVDIPSNQVHPMAASDGDFGGDLDAAA
LAYEQVLAASAAPGDPAPNFDVHLLGMGPEGHINSLFPHSPAVLESTRMVVAVDDSPKPP
PRRITLTLPAIQRSREVWLLVSGPGKADAVAAAIGGADPVSVPAAGAVGRQNTLWLLDRD
AAAKLPS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
gtgagcagtagcatcgagatcttccccgatagcgacattctggtcgcggccgcgggtaag
cgcttggttggcgccatcggggccgcggtggcggccagagggcaggcgctgatcgtgctg
accgggggcggcaacgggattgcgcttctgcgctacctcagcgcccaagcacagcagatt
gaatggtccaaggtgcacctgttctggggcgacgaacgctacgttcccgaagacgatgac
gagcgcaatctcaagcaggcccggcgggcgttgctcaatcacgtcgacattccatcgaac
caggtgcacccgatggccgccagtgatggtgacttcggcggcgatctggacgccgcggcc
ctggcctacgaacaggtgctggccgccagtgccgcaccaggtgacccggcgccgaatttc
gacgtccacctgctgggcatggggcccgagggccacattaactcgctgttcccgcacagc
cccgccgtcctcgagagcacccgcatggtggtggcggtcgacgactcgccgaaaccgccg
ccacgccgaatcaccttgaccctgccggcgattcagcgttcccgcgaggtgtggctgctg
gtttccgggccgggtaaggccgacgccgtggccgcggccatcggcggcgccgatccggtt
tcggtaccggcggccggggccgtcgggcgtcagaacacgctctggctgctggaccgcgac
gccgccgccaagcttccgagttaa

DBGET integrated database retrieval system