KEGG   Mycobacterium tuberculosis H37Rv: Rv1448cHelp
Entry
Rv1448c           CDS       T00015                                 

Gene name
tal
Definition
(RefSeq) transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00030  Pentose phosphate pathway
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mtu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv1448c (tal)
Enzymes [BR:mtu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     Rv1448c (tal)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TAL_FSA Bromo_MP Asp1
Motif
Other DBs
NCBI-GeneID: 886606
NCBI-ProteinID: NP_215964
TubercuList: Rv1448c
UniProt: P9WG33 I6YAK9
Position
complement(1626959..1628080)
Genome map
AA seq 373 aa AA seqDB search
MTAQNPNLAALSAAGVSVWLDDLSRDRLRSGNLQELIDTKSVVGVTTNPSIFQKALSEGH
TYDAQIAELAARGADVDATIRTVTTDDVRSACDVLVPQWEDSDGVDGRVSIEVDPRLAHE
TEKTIQQAIELWKIVDRPNLFIKIPATKAGLPAISAVLAEGISVNVTLIFSVQRYREVMD
AYLTGMEKARQAGHSLSKIHSVASFFVSRVDTEIDKRLDRIGSRQALELRGQAGVANARL
AYATYREVFEDSDRYRSLKVDGARVQRPLWASTGVKNPDYSDTLYVTELVAPHTVNTMPE
KTIDAVADHGVIQGDTVTGTASDAQAVFDQLGAIGIDLTDVFAVLEEEGVRKFEASWNEL
LQETRAHLDTAAQ
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaccgctcagaaccccaacctggccgcattgagcgccgcgggggtatcggtgtggctg
gatgacctgtcgcgggaccggctgcgctcgggcaatctgcaggagctgatcgacaccaag
agcgtcgtcggggtgaccaccaacccgtcgatctttcagaaggcgctgtcggagggccac
acctacgacgcccagatcgccgagctggccgcgcgcggcgccgacgtggatgccaccatc
cgcaccgtcaccactgacgacgtgcgcagcgcgtgcgacgtgctggtcccccagtgggag
gactccgacggggtcgacggccgggtgtcgatcgaggtcgacccgcggctggcacacgaa
accgaaaaaacgatccaacaggcaatcgagctgtggaagatcgtcgaccggccgaacctt
ttcatcaagatcccggccactaaggccggtctgcccgccatcagtgccgttctggcggaa
gggatttcggtcaacgttacgctgatcttctccgtgcagcggtaccgcgaggtgatggac
gcctacctgaccgggatggaaaaggcccggcaagccggacacagcctgtccaagatccat
tcggtggcatcgtttttcgtctcccgggtggacaccgaaatcgacaagcggctggacaga
atcggctcgcggcaagcgctcgaactgcgcggccaggccggtgtcgccaatgcccgcctg
gcctatgccacctaccgggaggtcttcgaagacagcgatcgttatcggtccctcaaggtc
gacggcgcccgggtccagcgcccgttgtgggcttccaccggcgtgaagaaccccgattac
tcggacaccctctacgtcaccgagttggtcgccccacacaccgtgaacactatgccggaa
aagacaattgacgccgtcgctgatcatggcgtgatccaaggcgacacggtcaccggaact
gcatccgatgcccaggcggtgttcgaccagctgggggcgatcggcatcgacctcaccgac
gtgtttgccgtcctcgaggaggaaggcgtgcggaagttcgaggcctcctggaacgagcta
ctccaggaaacccgggcgcatctcgacaccgctgcccaatga

DBGET integrated database retrieval system