KEGG   Mycobacterium tuberculosis H37Rv: Rv1449cHelp
Entry
Rv1449c           CDS       T00015                                 

Gene name
tkt
Definition
(RefSeq) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00030  Pentose phosphate pathway
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mtu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Rv1449c (tkt)
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    Rv1449c (tkt)
Enzymes [BR:mtu01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     Rv1449c (tkt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C XFP_C
Motif
Other DBs
NCBI-GeneID: 886638
NCBI-ProteinID: NP_215965
TubercuList: Rv1449c
UniProt: P9WG25 I6X1A1
Structure
PDB: 

Position
complement(1628097..1630199)
Genome map
AA seq 700 aa AA seqDB search
MTTLEEISALTRPRHPDYWTEIDSAAVDTIRVLAADAVQKVGNGHPGTAMSLAPLAYTLF
QRTMRHDPSDTHWLGRDRFVLSAGHSSLTLYIQLYLGGFGLELSDIESLRTWGSKTPGHP
EFRHTPGVEITTGPLGQGLASAVGMAMASRYERGLFDPDAEPGASPFDHYIYVIASDGDI
EEGVTSEASSLAAVQQLGNLIVFYDRNQISIEDDTNIALCEDTAARYRAYGWHVQEVEGG
ENVVGIEEAIANAQAVTDRPSFIALRTVIGYPAPNLMDTGKAHGAALGDDEVAAVKKIVG
FDPDKTFQVREDVLTHTRGLVARGKQAHERWQLEFDAWARREPERKALLDRLLAQKLPDG
WDADLPHWEPGSKALATRAASGAVLSALGPKLPELWGGSADLAGSNNTTIKGADSFGPPS
ISTKEYTAHWYGRTLHFGVREHAMGAILSGIVLHGPTRAYGGTFLQFSDYMRPAVRLAAL
MDIDTIYVWTHDSIGLGEDGPTHQPIEHLSALRAIPRLSVVRPADANETAYAWRTILARR
NGSGPVGLILTRQGVPVLDGTDAEGVARGGYVLSDAGGLQPGEEPDVILIATGSEVQLAV
AAQTLLADNDILARVVSMPCLEWFEAQPYEYRDAVLPPTVSARVAVEAGVAQCWHQLVGD
TGEIVSIEHYGESADHKTLFREYGFTAEAVAAAAERALDN
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
gtgaccacactcgaagagatctccgcgcttacccgaccgcgccatcccgactactggacc
gagatcgattcggctgccgtcgacaccatccgggtattggccgccgatgccgtccaaaag
gtcggcaacggtcatcctggaacggcgatgagcctggctccgttggcctacacgctgttt
cagcggacaatgcgtcacgatcccagcgacacacactggctgggccgcgatcggttcgtt
ttgtcggccgggcacagcagcctgaccctctacatccagctctacctcggcggcttcggc
ctggaactgtccgacattgagtcgttgcgcacctggggatccaagacccccggacacccg
gagttccgccacacccccggcgttgagatcaccaccggcccgctggggcagggactggcg
tcggcggtcgggatggcgatggcctcgcgctacgagcgcggcctgttcgacccggacgcc
gaaccgggcgccagccccttcgaccactacatctatgtcatcgcctccgacggtgacatc
gaagaaggggtgacctcggaggcgtcgtcgctggccgcggtccagcaactgggcaacctc
atcgtgttctacgaccgcaaccagatctcgatcgaggacgacaccaacatcgcgctgtgt
gaggacaccgcggcccgctaccgcgcgtacggctggcacgtgcaagaggttgagggcggt
gagaacgtcgtcggcatcgaggaggccatcgccaatgcgcaggcggtcaccgaccggccc
tcgttcatcgcgctgcgcaccgtcatcggctatccggcgccgaacctgatggacaccggc
aaggcgcacggcgcggcgctgggcgacgacgaggtggccgcagtcaagaagatcgtcggc
ttcgatccggacaagacgttccaggtccgcgaggacgtcctcacccacacccgagggctg
gtggcccgcggcaaacaggcccacgaacgctggcagctcgaattcgatgcctgggcgcgg
cgtgaacccgagcgcaaggcgctgctggaccggctgctcgcgcagaagttgcccgacggc
tgggacgccgacttgccccactgggaaccggggtccaaggcgctggccacccgtgcggcc
tcgggtgcggtgctgtccgcgctcgggccgaaactgcccgagttgtggggcggttcggcc
gacctggcgggcagcaacaacacaacgataaagggcgccgactcctttggcccgccctcg
atttccaccaaggagtacaccgcgcactggtatggtcgcaccttgcacttcggtgttcgc
gagcacgcgatgggtgccatcctgtccggcatcgtgctgcacggacccacccgggcttac
ggcggcaccttcctgcagttctccgactacatgcgcccggcggtgcggctggcggcgttg
atggacatcgacaccatctacgtctggacgcacgactcgatcggcctcggcgaagacggg
cccacccatcaaccgatcgagcacctctcggcgctgcgcgcgatcccccggctgtcggtg
gtgcgcccggcagatgccaacgagacagcctacgcctggcgcacgatcctggcccgccgc
aacggcagcgggccggtcgggttgatcctgacccgccagggtgtgccggtgctggacggc
accgacgccgagggggttgcccgcggcggttacgtgctgagtgacgccggtggtctgcaa
ccgggcgaggaacccgacgtcattctcatcgccaccggctcggaggtgcagctggcggtc
gcggcgcagacgttgctggcggacaacgacatcctcgctcgggtggtgtcgatgccgtgc
ctggagtggttcgaggcccaaccctacgagtaccgcgacgcggtgctgcccccgacggtg
tcggcgcgggtggccgtcgaagccggcgtcgcgcaatgctggcaccagctggttggcgac
acgggcgagatcgtctcgatcgagcactacggcgaatccgcggaccacaagaccttgttc
cgcgagtacggcttcactgccgaggccgtggccgccgccgccgaacgagcgctggataac
tga

DBGET integrated database retrieval system