KEGG   Mycobacterium tuberculosis H37Rv: Rv1475cHelp
Entry
Rv1475c           CDS       T00015                                 

Gene name
acn
Definition
(RefSeq) iron-regulated aconitate hydratase
  KO
K01681  aconitate hydratase [EC:4.2.1.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00020  Citrate cycle (TCA cycle)
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mtu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
mtu_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rv1475c (acn)
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1475c (acn)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.3  aconitate hydratase
     Rv1475c (acn)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-GeneID: 886545
NCBI-ProteinID: NP_215991
TubercuList: Rv1475c
UniProt: O53166
Position
complement(1663215..1666046)
Genome map
AA seq 943 aa AA seqDB search
MTSKSVNSFGAHDTLKVGEKSYQIYRLDAVPNTAKLPYSLKVLAENLLRNEDGSNITKDH
IEAIANWDPKAEPSIEIQYTPARVVMQDFTGVPCIVDLATMREAIADLGGNPDKVNPLAP
ADLVIDHSVIADLFGRADAFERNVEIEYQRNGERYQFLRWGQGAFDDFKVVPPGTGIVHQ
VNIEYLASVVMTRDGVAYPDTCVGTDSHTTMVNGLGVLGWGVGGIEAEAAMLGQPVSMLI
PRVVGFRLTGEIQPGVTATDVVLTVTEMLRQHGVVGKFVEFYGEGVAEVPLANRATLGNM
SPEFGSTAAIFPIDEETIKYLRFTGRTPEQVALVEAYAKAQGMWHDPKHEPEFSEYLELN
LSDVVPSIAGPKRPQDRIALAQAKSTFREQIYHYVGNGSPDSPHDPHSKLDEVVEETFPA
SDPGQLTFANDDVATDETVHSAAAHADGRVSNPVRVKSDELGEFVLDHGAVVIAAITSCT
NTSNPEVMLGAALLARNAVEKGLTSKPWVKTTIAPGSQVVNDYYDRSGLWPYLEKLGFYL
VGYGCTTCIGNSGPLPEEISKAVNDNDLSVTAVLSGNRNFEGRINPDVKMNYLASPPLVI
AYALAGTMDFDFQTQPLGQDKDGKNVFLRDIWPSQQDVSDTIAAAINQEMFTRNYADVFK
GDDRWRNLPTPSGNTFEWDPNSTYVRKPPYFEGMTAKPEPVGNISGARVLALLGDSVTTD
HISPAGAIKPGTPAARYLDEHGVDRKDYNSFGSRRGNHEVMIRGTFANIRLRNQLLDDVS
GGYTRDFTQPGGPQAFIYDAAQNYAAQHIPLVVFGGKEYGSGSSRDWAAKGTLLLGVRAV
IAESFERIHRSNLIGMGVIPLQFPEGKSASSLGLDGTEVFDITGIDVLNDGKTPKTVCVQ
ATKGDGATIEFDAVVRIDTPGEADYYRNGGILQYVLRNILKSG
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
gtgactagcaaatctgtgaactcattcggagcccacgacaccctgaaggtcggcgaaaag
agttaccagatctatcgtctcgacgccgtccccaataccgcgaaactcccctacagcctc
aaagtgctcgccgagaacctgttgcgcaacgaggacggcagcaacatcaccaaggaccac
atcgaggccatcgccaactgggaccctaaggccgagcccagcatcgagatccagtacacg
cccgcccgggtggtgatgcaggacttcaccggcgtaccgtgcatcgtcgacttggccacc
atgcgcgaggcgatcgccgatctgggcggcaacccggacaaggtcaacccgctggcgccc
gcagacttggtgatcgaccactcggtgatcgccgatttgttcggccgcgccgacgcattc
gagcgcaacgtcgaaatcgaataccagcgcaacggtgagcgttaccaattcctgcgctgg
ggccaaggcgctttcgacgacttcaaagtggtgccgccgggcaccggcatcgtgcaccag
gtcaatatcgagtacctggccagcgtggtgatgactcgcgacggagtggcctaccccgac
acctgcgtgggcaccgactcacacaccaccatggtcaacggcctgggtgtgctcgggtgg
ggtgtcggcggcatcgaggcggaggccgcgatgctgggtcagccggtatcgatgctgatc
ccgcgggtcgtgggtttcaggttgaccggcgagatccagccgggagtcaccgccaccgac
gtggtgttgaccgtcaccgagatgctgcgccagcacggcgtcgtcggcaaattcgtcgag
ttctacggcgagggcgtggccgaggtgccgctggccaaccgcgccaccctgggcaacatg
agtcccgaattcggttccaccgcagcgattttcccgatcgacgaagaaaccatcaagtat
ctgcggtttaccggtcgcacgccggagcaggtcgcactggtcgaggcctacgccaaggcg
cagggcatgtggcacgatcccaagcacgagccggagttctcggaatacctcgaactcaac
ctatccgacgtggtgccgtcgatcgccggaccaaagcgtccacaggaccgaatcgcgttg
gcgcaagccaaatcaacattccgcgagcagatttaccactatgtcggcaatggttccccg
gattccccccacgacccgcactcgaagctggacgaggtagtcgaggagacattcccggcc
agcgacccggggcagctgacgttcgccaacgacgacgtcgccactgacgaaaccgtgcac
tcggctgccgcgcatgccgatggccgggtgagcaacccagtgcgggtgaagtcggacgaa
ctcggcgaattcgtgctcgaccacggcgcggtggtgattgccgcgatcacgtcctgcacc
aacacctccaaccccgaagtaatgctgggcgcggcgctgctggcccgcaacgccgtcgaa
aagggactgacctcgaagccgtgggtgaagaccacgattgccccgggctcgcaagtggtc
aacgactactacgacagatccggcctgtggccgtatctggagaagctcggcttctatctg
gtcggctacggctgcaccacctgcatcggcaactccgggccgctgcccgaggaaatctca
aaagcggttaacgacaacgacctttcggtgaccgcggtactgtccggcaaccggaacttc
gagggccgtatcaacccagacgtgaagatgaactacctggcatcgccgccgctggtcatc
gcctacgcgctggccgggaccatggacttcgacttccaaacccagccgctcggtcaagac
aaagacggtaagaacgtttttctccgcgatatctggccatcgcagcaggatgtctccgac
accatcgccgcggcgatcaaccaggagatgttcacccgcaactacgccgacgtgttcaag
ggcgacgaccgctggcgcaacctgccaaccccgagcggcaacacctttgagtgggacccg
aattcgacctacgtgcgcaagccgccgtatttcgaggggatgacagccaaacccgaaccg
gtcggcaacatcagcggtgcccgggtgctggcgctgctcggtgattcggtgaccaccgac
cacatctcccccgccggcgccatcaagcccggaactcccgcggcgcgctacctcgacgaa
cacggtgtcgaccgcaaggactacaactccttcggttctcgccgcggcaaccacgaggtg
atgattcgtggcaccttcgccaacatccggctgcgtaaccaactgctagacgacgtgtcc
ggcggttatacccgcgacttcacccagccgggcggtccgcaggcgttcatctacgacgcc
gcgcagaactatgcggcgcaacacattccgctggttgtgttcggcggcaaagagtacggg
tcgggttcgtcacgggactgggcggccaaaggcacattgctactgggcgtgcgggcggtg
atcgccgagtcattcgagcggatccaccggtccaacctgatcggcatgggcgtgatcccg
ctgcagttccccgaaggaaagtcagcgtcgtcgttgggactcgacggtaccgaggtcttc
gacatcaccggtatcgacgtgcttaacgacggcaagacacccaagacggtgtgcgtccag
gccaccaagggcgacggcgccacgatcgagttcgacgccgtggtgcgcatcgacaccccc
ggtgaggcggactactaccgcaacggcggcatcctgcagtacgtgctgcgcaacatactg
aagtcaggctga

DBGET integrated database retrieval system