KEGG   Mycobacterium tuberculosis H37Rv: Rv1485Help
Entry
Rv1485            CDS       T00015                                 

Gene name
hemZ
Definition
(RefSeq) ferrochelatase
  KO
K01772  protoporphyrin/coproporphyrin ferrochelatase [EC:4.99.1.1 4.99.1.9]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00860  Porphyrin and chlorophyll metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv1485 (hemZ)
Enzymes [BR:mtu01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.1  protoporphyrin ferrochelatase
     Rv1485 (hemZ)
    4.99.1.9  coproporphyrin ferrochelatase
     Rv1485 (hemZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferrochelatase
Motif
Other DBs
NCBI-GeneID: 886525
NCBI-ProteinID: NP_216001
TubercuList: Rv1485
UniProt: P9WNE3 I6XY22
Position
1675017..1676051
Genome map
AA seq 344 aa AA seqDB search
MQFDAVLLLSFGGPEGPEQVRPFLENVTRGRGVPAERLDAVAEHYLHFGGVSPINGINRT
LIAELEAQQELPVYFGNRNWEPYVEDAVTAMRDNGVRRAAVFATSAWSGYSSCTQYVEDI
ARARRAAGRDAPELVKLRPYFDHPLFVEMFADAITAAAATVRGDARLVFTAHSIPTAADR
RCGPNLYSRQVAYATRLVAAAAGYCDFDLAWQSRSGPPQVPWLEPDVTDQLTGLAGAGIN
AVIVCPIGFVADHIEVVWDLDHELRLQAEAAGIAYARASTPNADPRFARLARGLIDELRY
GRIPARVSGPDPVPGCLSSINGQPCRPPHCVASVSPARPSAGSP
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcaatttgatgccgtcctgctgctgtcgttcggcggaccggaagggcccgagcaggtg
cggccgttcctggagaacgttacccggggccgcggtgtgcctgccgaacggttggacgcg
gtggccgagcactacctgcatttcggtggggtatcaccgatcaatggcattaatcgcaca
ctgatcgcggagctggaggcgcagcaagaactgccggtgtacttcggtaaccgcaactgg
gagccgtatgtagaagatgccgttacggccatgcgcgacaacggtgtccggcgtgcagcg
gtctttgcgacatctgcgtggagcggttactcgagctgcacacagtacgtggaggacatc
gcgcgggcccgccgcgcggccgggcgcgacgcgcctgaactggtaaaactgcggccctac
ttcgaccatccgctgttcgtcgagatgttcgccgacgccatcaccgcggccgccgcaacc
gtgcgcggtgatgcccggctggtgttcaccgcgcattcgatcccgacggccgccgaccgc
cgctgtggccccaacctctacagccgccaagtcgcctacgccacaaggctggtcgcggcc
gctgccggatactgcgactttgacctggcctggcagtcgagatcgggcccgccgcaggtg
ccctggctggagccagacgttaccgaccagctcaccggtctggctggggccggcatcaac
gcggtgatcgtgtgtcccattggattcgtcgccgaccatatcgaggtggtgtgggatctc
gaccacgagttgcgattacaagccgaggcagcgggcatcgcgtacgcccgggccagcacc
cccaatgccgacccgcggttcgctcgactagccagaggtttgatcgacgaactccgttac
ggccgtatacctgcgcgggtgagtggccccgatccggtgccgggctgtctgtccagcatc
aacggccagccatgccgtccgccgcactgcgtggctagcgtcagtccggccaggccgagt
gcaggatcgccgtga

DBGET integrated database retrieval system