KEGG   Mycobacterium tuberculosis H37Rv: Rv1492Help
Entry
Rv1492            CDS       T00015                                 

Gene name
mutA
Definition
(RefSeq) methylmalonyl-CoA mutase small subunit
  KO
K01847  methylmalonyl-CoA mutase [EC:5.4.99.2]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00280  Valine, leucine and isoleucine degradation
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu00640  Propanoate metabolism
mtu01100  Metabolic pathways
mtu01120  Microbial metabolism in diverse environments
mtu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv1492 (mutA)
   00640 Propanoate metabolism
    Rv1492 (mutA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Rv1492 (mutA)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.2  methylmalonyl-CoA mutase
     Rv1492 (mutA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MM_CoA_mutase
Motif
Other DBs
NCBI-GeneID: 886507
NCBI-ProteinID: NP_216008
TubercuList: Rv1492
UniProt: P9WJK7 I6X1E6
Position
1682157..1684004
Genome map
AA seq 615 aa AA seqDB search
MSIDVPERADLEQVRGRWRNAVAGVLSKSNRTDSAQLGDHPERLLDTQTADGFAIRALYT
AFDELPEPPLPGQWPFVRGGDPLRDVHSGWKVAEAFPANGATADTNAAVLAALGEGVSAL
LIRVGESGVAPDRLTALLSGVYLNLAPVILDAGADYRPACDVMLALVAQLDPGQRDTLSI
DLGADPLTASLRDRPAPPIEEVVAVASRAAGERGLRAITVDGPAFHNLGATAATELAATV
AAAVAYLRVLTESGLVVSDALRQISFRLAADDDQFMTLAKMRALRQLWARVAEVVGDPGG
GAAVVHAETSLPMMTQRDPWVNMLRCTLAAFGAGVGGADTVLVHPFDVAIPGGFPGTAAG
FARRIARNTQLLLLEESHVGRVLDPAGGSWFVEELTDRLARRAWQRFQAIEARGGFVEAH
DFLAGQIAECAARRADDIAHRRLAITGVNEYPNLGEPALPPGDPTSPVRRYAAGFEALRD
RSDHHLARTGARPRVLLLPLGPLAEHNIRTTFATNLLASGGIEAIDPGTVDAGTVGNAVA
DAGSPSVAVICGTDARYRDEVADIVQAARAAGVSRVYLAGPEKALGDAAHRPDEFLTAKI
NVVQALSNLLTRLGA
NT seq 1848 nt NT seq  +upstreamnt  +downstreamnt
gtgtccattgatgtacccgagcgtgccgacctagaacaggttcgcgggcgctggcgcaac
gcggttgccggtgtgctgtccaagagcaaccgtaccgactcagcacaactcggcgatcac
cccgagcggctgctggatacccagaccgctgacgggttcgccatccgggccctctacacc
gcgttcgacgagctcccggagccgccgttgccgggccagtggccctttgtgcgcggcgga
gacccgctgcgcgacgtgcattccggctggaaggtcgccgaggcgtttcccgccaacggt
gcgacggccgacaccaacgcggcggtgctggccgcgctcggcgagggggtcagcgcgctg
ctgatccgggtgggggagtcgggtgtggcgcctgaccggctcacggcgctgctgtccggg
gtgtatctgaacctggcgccggtcatcctcgacgccggcgccgactaccgcccggcctgc
gacgtcatgctggcgctggtcgcccagctcgatcccggccagcgcgacaccctgtcgatc
gacctgggcgccgacccgctgacggcgtcgctgcgcgatcgtcccgccccgccgatcgag
gaggtcgtcgcggtcgcatcccgggcggccggcgaacgtgggcttcgtgcgatcaccgtc
gacggaccggccttccacaacctgggcgcgaccgcggccaccgaactcgcggccaccgtc
gcggccgcggtggcctacctgcgggtgctcaccgaatccgggctcgtggtgagtgacgcg
ctgcggcagatcagcttccggctcgccgccgacgacgaccagttcatgacgctggccaag
atgcgggctctacgtcaactgtgggcgcgggtcgccgaggtcgtgggcgacccgggtggc
ggcgcggccgtcgtgcacgcggagacgtcgctaccgatgatgacccagcgtgatccgtgg
gtgaacatgctgcgctgcacgctggcggccttcggcgccggtgtcggtggcgcggacacc
gtgctggtgcacccgttcgacgtggcgattcccggcggctttcccggcacggcggccggc
tttgcgcgccggatcgctcgcaacacccaactgctgcttttagaagagtcgcatgtcggc
agggtgctcgatcccgccggcgggtcgtggttcgtcgaagagctcaccgaccggctggct
cggcgcgcctggcagcgtttccaggccatcgaggcccgtggcggcttcgtcgaggcccac
gacttcctggccggccagatcgccgagtgcgccgcccgccgcgccgacgacatcgcccat
cggcgcctggcgatcaccggcgtcaacgaatacccgaacctgggcgaacccgcgctgccg
cccggtgatccgacatcgccggtgcgccgctacgctgccggattcgaagcattgcgcgat
cgatccgatcaccacctagcccgcactggcgcacggccgcgggtgctgttgctgccgttg
ggtccgctggccgagcacaacatccggacgaccttcgccaccaacctgctggcgtccggc
ggcatcgaggcgatcgacccgggaacggttgatgcgggcaccgtcgggaatgccgttgcc
gatgccggttcgcccagcgttgccgtgatctgcggcaccgatgcgcgctaccgggacgag
gttgccgacattgtgcaagcggcccgagccgccggtgtttcgagggtgtacctcgcgggt
cccgagaaggcgttgggagatgccgcacaccggcccgacgagtttttgaccgcgaaaatc
aatgtggtgcaagccttgtcgaatctgctgacgcggttgggggcctag

DBGET integrated database retrieval system