KEGG   Mycobacterium tuberculosis H37Rv: Rv1500Help
Entry
Rv1500            CDS       T00015                                 

Definition
(RefSeq) glycosyltransferase
  KO
K13670  putative glycosyltransferase [EC:2.4.-.-]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.-  Glycosyltransferases
    2.4.-.-  
     Rv1500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 DUF373
Motif
Other DBs
NCBI-GeneID: 886492
NCBI-ProteinID: NP_216016
TubercuList: Rv1500
UniProt: P9WMX5 I6YAR1
Position
1690850..1691878
Genome map
AA seq 342 aa AA seqDB search
MRLSIVTTMYMSEPYVLEFYRRARAAADKITPDVEIIFVDDGSPDAALQQAVSLLDSDPC
VRVIQLSRNFGHHKAMMTGLAHATGDLVFLIDSDLEEDPALLEPFYEKLISTGADVVFGC
HARRPGGWLRNFGPKIHYRASALLCDPPLHENTLTVRLMTADYVRSLVQHQERELSIAGL
WQITGFYQVPMSVNKAWKGTTTYTFRRKVATLVDNVTSFSNKPLVFIFYLGAAIFIISSS
AAGYLIIDRIFFRALQAGWASVIVSIWMLGGVTIFCIGLVGIYVSKVFIETKQRPYTIIR
RIYGSDLTTREPSSLKTAFPAAHLSNGKRVTSEPEGLATGNR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctctcgatcgtaacgactatgtacatgtcagagccttacgtgctggagttctac
aggagagcgcgcgcggcggcggacaaaatcacgcctgacgtcgagatcatcttcgtggat
gacggctcgccggacgcagcgctccagcaggccgtctcgctgctcgacagcgacccctgt
gttcgggtaattcagctttcgcgaaatttcggccaccacaaagcgatgatgaccggcctg
gcgcacgccacgggggatctcgtctttctgatcgactcagacttggaagaggacccggct
ctcctagagccgttctatgaaaagctgatctcgacgggcgccgacgtagtatttggttgc
cacgcgcggcggcccggcggttggttgaggaatttcggaccgaaaatccattatcgggcg
tccgccctgctgtgtgaccccccgcttcatgaaaatactctcaccgtgcggctgatgaca
gccgactatgtacgcagcttggtccagcaccaggagcgtgaactttcgattgccggtctg
tggcagattactggtttttaccaggtgcccatgtccgtaaacaaggcatggaaaggaacg
accacatacacgtttaggcgtaaagtagcgacactggtcgacaatgtcacttcatttagc
aacaaacctctagtcttcattttctatcttggtgcggccatttttattatttcaagctcg
gccgcgggctatctgatcatcgatcgaattttctttcgcgctctgcaagcggggtgggca
tccgtgatcgtatccatctggatgctggggggtgtgacgattttctgcatagggctggtc
ggaatttatgtatccaaagtcttcatcgaaactaagcagcggccatacacaattatccga
agaatctacggttcggatttaacaacccgggagccatcctctctgaagaccgccttcccg
gccgcgcacctgtcgaacgggaaacgcgtcacatcagagccagagggattggcaactggc
aacaggtga

DBGET integrated database retrieval system