KEGG   Mycobacterium tuberculosis H37Rv: Rv1512Help
Entry
Rv1512            CDS       T00015                                 

Gene name
epiA
Definition
(RefSeq) nucleotide-sugar epimerase EpiA
  KO
K02377  GDP-L-fucose synthase [EC:1.1.1.271]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00051  Fructose and mannose metabolism
mtu00520  Amino sugar and nucleotide sugar metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Rv1512 (epiA)
   00520 Amino sugar and nucleotide sugar metabolism
    Rv1512 (epiA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.271  GDP-L-fucose synthase
     Rv1512 (epiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd RmlD_sub_bind NAD_binding_10
Motif
Other DBs
NCBI-GeneID: 886461
NCBI-ProteinID: NP_216028
TubercuList: Rv1512
UniProt: P71791 A0A089QKS3
Position
1704093..1705061
Genome map
AA seq 322 aa AA seqDB search
MNAHTSVGPLDRAARVYIAGHRGLVGSALLRTFAGAGFTNLLVRSRAELDLTDRAATFDF
VLESRPQVVIDAAARVGGILANDTYPADFLSENLQIQVNLLDAAVAARVPRLLFLGSSCI
YPKLAPQPIPESALLTGPLEPTNDAYAIAKIAGILAVQAVRRQHGLPWISAMPTNLYGPG
DNFSPSGSHLLPALIRRYDEAKASGAPNVTNWGTGTPRRELLHVDDLASACLYLLEHFDG
PTHVNVGTGIDHTIGEIAEMVASAVGYSGETRWDPSKPDGTPRKLLDVSVLREAGWRPSI
ALRDGIEATVAWYREHAGTVRQ
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgcacacctcggtcggcccgcttgaccgcgcggcccgggtctacatcgccggg
catcgcggcctggtcgggtccgcgctgctacgcacgtttgcgggcgcggggttcaccaac
ctgctggtgcggtcacgcgccgagcttgatctgacggatcgggccgcgacgttcgacttc
gttctcgagtcgaggccgcaggtcgtcatcgacgcggcggcccgggtcggcggcatcctg
gccaacgacacctacccggccgatttcctgtcggaaaacctccagatccaggtcaacctg
ctggatgccgccgtggcggcgcgggtgccgcggctgctgttcctgggctcgtcgtgcatc
tacccgaaactcgccccgcagccgatcccggagagcgcgctgctcaccggtccgttggag
ccgaccaacgacgcgtacgcgatcgccaaaatcgccggcatccttgcggtccaggcggtg
cgccgccaacatggcctgccgtggatctcggcgatgcccaccaacctgtacgggccaggc
gacaacttttcgccgtccggctcgcatctgctgccggcactcatccgccgctatgacgag
gccaaagccagtggcgcgcccaacgtgaccaactggggcaccggcacgccccgacgggag
ttgctgcacgtcgacgacctggcgagcgcatgcctgtatctgctggaacatttcgacggg
ccgacccatgtcaacgtgggaaccggcatcgaccacaccatcggcgagatcgccgagatg
gtcgcctcggcggtaggctatagcggcgaaacccgctgggatccaagcaaaccggacgga
acaccacgcaaactgctggatgtttcggtgctacgggaggcgggatggcggccttcgatc
gcgctgcgcgacggcatcgaggcgacggtggcgtggtatcgcgagcacgcgggaacggtt
cggcaatga

DBGET integrated database retrieval system