KEGG   Mycobacterium tuberculosis H37Rv: Rv1538cHelp
Entry
Rv1538c           CDS       T00015                                 

Gene name
ansA
Definition
(RefSeq) L-aparaginase
  KO
K01424  L-asparaginase [EC:3.5.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00250  Alanine, aspartate and glutamate metabolism
mtu00460  Cyanoamino acid metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv1538c (ansA)
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Rv1538c (ansA)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.1  asparaginase
     Rv1538c (ansA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asparaginase Asparaginase_C
Motif
Other DBs
NCBI-GeneID: 886410
NCBI-ProteinID: NP_216054
TubercuList: Rv1538c
UniProt: P9WPX5 I6YAV2
Position
complement(1741212..1742192)
Genome map
AA seq 326 aa AA seqDB search
MGANHVRNDPIMARLTVITTGGTISTTAGPDGVLRPTHCGATLIAGLDMDSDIEVVDLMA
LDSSKLTPADWDRIGAAVQEAFRGGADGVVITHGTDTLEETALWLDLTYAGSRPVVLTGA
MLSADAPGADGPANLRDALAVAADPAARDLGVLVSFGGRVLQPLGLHKVANPDLCGFAGE
SLGFTSGGVRLTRTKTRPYLGDLGAAVAPRVDIVAVYPGSDAVAMDACVAAGARAVVLEA
LGSGNAGAAVIEGVRRHCRDGSDPVVIAVSTRVAGARVGAGYGPGHDLVEAGAVMVPRLP
PSQARVLLMAALAANSPVADVIDRWG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggagcaaaccacgtgcgcaatgatcccatcatggcccgcctcaccgtcatcactact
ggagggacaatctcgaccaccgccggccccgatggggtgctacggccaacccattgcggg
gcgacgctgatcgccggtctcgacatggactccgacatcgaagtagtcgacctcatggcg
ctggacagctcaaagttgacgccggccgattgggaccggataggcgctgcagtgcaggag
gcattccgcggcggcgcagatggggtggtcatcactcacggcaccgatacgctcgaagag
accgctctgtggctggacctcacctatgcgggtagccgcccggtcgtgttgaccggggcc
atgctcagcgccgatgcccccggcgccgatggcccggccaatctgcgcgacgcgcttgcg
gtcgccgccgacccagccgcccgcgacctcggggtgctggtgagtttcggcggccgggtg
ttacagcctttgggcctgcacaaggtggccaacccggacctgtgcggattcgccggcgag
tcgcttggcttcacgtcgggcggggtgcggctgacgcgcaccaagacgcggccctatctc
ggcgatctgggcgctgccgtggcgccacgagtcgacatcgtcgccgtctatccgggaagt
gacgcggtggcgatggacgcctgtgtggcagccggcgcgcgcgccgtggtgctggaggcg
ctgggctcgggcaatgccggggccgccgtgatcgagggagtccgtcgccactgtcgagac
gggagcgatccggtggtgatcgcggtgtctacccgggtcgccggcgcgcgggtcggcgca
ggctatggtcccgggcacgacctggtggaggctggcgcggtgatggtaccgcgactgccg
ccgtcccaggcccgggtgctgctaatggccgcgctggcggccaactcaccggtcgccgac
gtcatcgaccgttggggctga

DBGET integrated database retrieval system