KEGG   Mycobacterium tuberculosis H37Rv: Rv1559Help
Entry
Rv1559            CDS       T00015                                 

Gene name
ilvA
Definition
(RefSeq) threonine dehydratase IlvA
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00290  Valine, leucine and isoleucine biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv1559 (ilvA)
   00290 Valine, leucine and isoleucine biosynthesis
    Rv1559 (ilvA)
Enzymes [BR:mtu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     Rv1559 (ilvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_dehydrat_C DAGK_cat
Motif
Other DBs
NCBI-GeneID: 886365
NCBI-ProteinID: NP_216075
TubercuList: Rv1559
UniProt: P9WG95 I6Y6V4
Position
1763428..1764717
Genome map
AA seq 429 aa AA seqDB search
MSAELSQSPSSSPLFSLSGADIDRAAKRIAPVVTPTPLQPSDRLSAITGATVYLKREDLQ
TVRSYKLRGAYNLLVQLSDEELAAGVVCSSAGNHAQGFAYACRCLGVHGRVYVPAKTPKQ
KRDRIRYHGGEFIDLIVGGSTYDLAAAAALEDVERTGATLVPPFDDLRTIAGQGTIAVEV
LGQLEDEPDLVVVPVGGGGCIAGITTYLAERTTNTAVLGVEPAGAAAMMAALAAGEPVTL
DHVDQFVDGAAVNRAGTLTYAALAAAGDMVSLTTVDEGAVCTAMLDLYQNEGIIAEPAGA
LSVAGLLEADIEPGSTVVCLISGGNNDVSRYGEVLERSLVHLGLKHYFLVDFPQEPGALR
RFLDDVLGPNDDITLFEYVKRNNRETGEALVGIELGSAADLDGLLARMRATDIHVEALEP
GSPAYRYLL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
gtgtccgccgaactgagccagagcccgagcagctcgccgctgttttcactatctggggca
gacatcgaccgtgccgccaagcggatcgcaccggtagtcacgcccaccccgttgcaacct
agcgatcggttgtcggcgatcactggcgccacggtctacctcaagcgcgaagacttgcag
acggtgcgctcttataagctacgcggagcgtacaacctgttggtgcagttgtccgatgag
gaactggccgcgggcgtggtgtgttcttctgcgggcaaccacgcgcagggcttcgcgtat
gcgtgtcgctgtctgggtgtgcacggccgggtctacgtacctgccaaaacccccaagcag
aagcgtgaccggatccgctaccacggcggggagttcatcgacctgatcgtgggtgggtcg
acctatgatctggctgcggcggcggcccttgaggacgtggaacgcaccggggccacgctg
gtaccgccgtttgacgacctgcgcaccatcgccggccagggcacgatagccgtcgaagtg
cttggccagctcgaggacgagccggacctggtggtggtcccggtgggtggcggcggctgc
atcgcggggatcaccacctacctggccgagcggacgaccaacaccgcggtgctgggcgtc
gagccggctggtgcggccgccatgatggccgcgctcgcggcgggcgagccggtgacgctg
gaccatgtcgaccagttcgtcgacggcgccgcggtgaaccgggcgggcacgctgacctat
gccgcgctagccgccgccggcgacatggtttcgctcaccaccgtcgacgagggtgcggtg
tgcacggcgatgctcgatctgtatcagaacgagggcatcatcgccgaaccggccggtgcc
ctgtcggtcgccggtctgttggaagccgacatcgagcccgggtccaccgtggtgtgcctg
atttcgggcggcaacaacgacgtgtcccgttacggggaggtgttggagcgctcgctggtc
cacctgggcctcaagcactatttcctggtcgacttcccgcaggagcccggtgcgctgcgc
cggtttctcgacgacgtgctcggacccaacgacgacatcaccttgttcgagtacgtcaag
cgcaacaaccgggagaccggtgaggcgctggtgggtatcgagctgggatcggccgcggat
ctagacggtctgctggcccggatgcgggcgaccgacattcacgtcgaggcgttggaaccg
gggtcgccggcttaccgctatctgctgtag

DBGET integrated database retrieval system