KEGG   Mycobacterium tuberculosis H37Rv: Rv1568Help
Entry
Rv1568            CDS       T00015                                 

Gene name
bioA
Definition
(RefSeq) adenosylmethionine--8-amino-7-oxononanoate aminotransferase BioA
  KO
K00833  adenosylmethionine---8-amino-7-oxononanoate aminotransferase [EC:2.6.1.62]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00780  Biotin metabolism
mtu01100  Metabolic pathways
Module
mtu_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Rv1568 (bioA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtu01007]
    Rv1568 (bioA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.62  adenosylmethionine---8-amino-7-oxononanoate transaminase
     Rv1568 (bioA)
Amino acid related enzymes [BR:mtu01007]
 Aminotransferase (transaminase)
  Class III
   Rv1568 (bioA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 886343
NCBI-ProteinID: NP_216084
TubercuList: Rv1568
UniProt: P9WQ81 I6X1M8
Structure
PDB: 

Position
1775392..1776705
Genome map
AA seq 437 aa AA seqDB search
MAAATGGLTPEQIIAVDGAHLWHPYSSIGREAVSPVVAVAAHGAWLTLIRDGQPIEVLDA
MSSWWTAIHGHGHPALDQALTTQLRVMNHVMFGGLTHEPAARLAKLLVDITPAGLDTVFF
SDSGSVSVEVAAKMALQYWRGRGLPGKRRLMTWRGGYHGDTFLAMSICDPHGGMHSLWTD
VLAAQVFAPQVPRDYDPAYSAAFEAQLAQHAGELAAVVVEPVVQGAGGMRFHDPRYLHDL
RDICRRYEVLLIFDEIATGFGRTGALFAADHAGVSPDIMCVGKALTGGYLSLAATLCTAD
VAHTISAGAAGALMHGPTFMANPLACAVSVASVELLLGQDWRTRITELAAGLTAGLDTAR
ALPAVTDVRVCGAIGVIECDRPVDLAVATPAALDRGVWLRPFRNLVYAMPPYICTPAEIT
QITSAMVEVARLVGSLP
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggcgactggcgggttgacgcccgagcagatcatcgcggtcgatggcgcccat
ctgtggcacccttacagctccatcggcagggaagccgtgtcgccggtggtggccgtcgcc
gcccacggagcgtggttgacgctgattcgcgacggccagccgatcgaggtgctcgacgcg
atgagctcctggtggaccgcgatccacgggcacggccaccccgctctggaccaggcgtta
accacccagttgcgggtgatgaaccacgtcatgttcggggggctgactcacgagccggcg
gcccggctggcgaagctgctggtcgacatcaccccggcgggtctcgacacggtgttcttc
agcgactccggctcggtgtcggtggaagtcgcggccaagatggcgctgcagtactggcgc
ggccgcggcctgcccggcaagcgacggctcatgacctggcgcggcggctatcacggcgac
accttcctggctatgagcatctgcgacccgcacggcggcatgcactcgctgtggaccgac
gtcctggccgcccaagtgttcgcgccacaagtgccacgggactacgatcccgcctacagc
gcggcgttcgaggcgcagctggcgcagcacgccggcgagctggccgcggtggtcgtggag
ccggtcgtgcagggtgcgggcggtatgcgttttcacgacccgcgctatctgcacgacctg
cgggacatctgccgccgttacgaggtgctgctgatcttcgatgagatcgccaccggcttc
ggccgcaccggcgcgttgttcgccgccgaccacgccggggtgagcccggacatcatgtgt
gtcggcaaggcgctcaccggcggctacctcagcttggccgccaccttgtgcaccgccgac
gtcgcgcacaccatcagcgccggtgcggccggggcgctgatgcacggccccaccttcatg
gccaatccgctggcctgtgcggtctcggtggccagtgtggagctgctgctcggccaggac
tggcgcacgcgcatcaccgaactggccgccgggctgaccgccggcctggataccgcccgg
gcgctgcccgccgtcaccgatgtgcgggtgtgcggcgcgatcggcgtcatcgaatgcgac
cgaccggtcgacctggccgtcgcgactcccgcggcgctggatcgaggcgtgtggctgcgc
ccgtttcgcaacctggtctacgccatgccgccctatatctgcacaccggccgagatcacg
cagatcacctcggcgatggtcgaggtcgcacggctcgtaggctcactgccatga

DBGET integrated database retrieval system