KEGG   Mycobacterium tuberculosis H37Rv: Rv1569Help
Entry
Rv1569            CDS       T00015                                 

Gene name
bioF1
Definition
(RefSeq) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00780  Biotin metabolism
mtu01100  Metabolic pathways
Module
mtu_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Rv1569 (bioF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtu01007]
    Rv1569 (bioF1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     Rv1569 (bioF1)
Amino acid related enzymes [BR:mtu01007]
 Aminotransferase (transaminase)
  Class II
   Rv1569 (bioF1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Cys_Met_Meta_PP Beta_elim_lyase Aminotran_3
Motif
Other DBs
NCBI-GeneID: 886345
NCBI-ProteinID: YP_177822
TubercuList: Rv1569
UniProt: P9WQ87 I6Y6W5
Position
1776702..1777862
Genome map
AA seq 386 aa AA seqDB search
MKAATQARIDDSPLAWLDAVQRQRHEAGLRRCLRPRPAVATELDLASNDYLGLSRHPAVI
DGGVQALRIWGAGATGSRLVTGDTKLHQQFEAELAEFVGAAAGLLFSSGYTANLGAVVGL
SGPGSLLVSDARSHASLVDACRLSRARVVVTPHRDVDAVDAALRSRDEQRAVVVTDSVFS
ADGSLAPVRELLEVCRRHGALLLVDEAHGLGVRGGGRGLLYELGLAGAPDVVMTTTLSKA
LGSQGGVVLGPTPVRAHLIDAARPFIFDTGLAPAAVGAARAALRVLQAEPWRPQAVLNHA
GELARMCGVAAVPDSAMVSVILGEPESAVAAAAACLDAGVKVGCFRPPTVPAGTSRLRLT
ARASLNAGELELARRVLTDVLAVARR
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccacgcaggcacggatcgacgattcaccgttggcctggttggacgcggtg
cagcggcagcgccacgaggccggactgcggcgctgcctgcggccgcgtcccgcggtcgcc
accgagctggacttggcctccaacgactatctcggtctgtcccgacatcccgccgtcatc
gacggcggcgtccaggcgctgcggatctggggcgccggcgccaccgggtcgcgcctggtt
accggcgacaccaagctgcaccagcaattcgaggccgagctcgccgagttcgtcggcgct
gccgcgggattgctgttctcctctggctacacggccaacctgggcgccgtggtcggcctg
tccggcccgggttccctgctggtgtccgacgcccgttcgcatgcgtcgttggtggatgcc
tgtcggctgtcgcgggcgcgggttgtggtgacgccgcaccgcgacgtcgacgccgtggac
gccgcgctgcgatcgcgcgacgagcagcgcgccgtcgtcgtcaccgactcggtgttcagc
gccgacggctcgctggcgccggttcgggagttgcttgaggtctgccggcgtcatggtgcg
ctgcttctggtggacgaggcgcacggcctgggtgtgcgtggcggcggacgcgggctgctc
tacgagttaggtctagcgggtgcgcccgacgtggtgatgaccaccacgctgtccaaggcg
ctgggcagccagggtggtgtggtgctcgggccgacgccggtgcgggcccatctgatcgat
gctgcccggccgttcatcttcgacaccggtctggcgccggcggcggtgggtgccgcacgg
gccgcgctgcgcgtcttgcaggccgagccgtggcgaccgcaggcggtgctcaaccacgct
ggtgaacttgcgcggatgtgcggtgtggctgcggtgccggactcggcgatggtgtcggtg
atcctgggcgagccggagtcggcagtggccgccgcggcggcctgcctggacgccggggtc
aaggtgggctgcttccggccgccgacggtgcccgcgggtacgtcgcggctgcggctgacc
gcgcgcgcatcgctgaacgccggcgagctcgagctggcccggcgggtgctgacggatgtt
ctcgccgtggcgcgccgttga

DBGET integrated database retrieval system