KEGG   Mycobacterium tuberculosis H37Rv: Rv1570Help
Entry
Rv1570            CDS       T00015                                 

Gene name
bioD
Definition
(RefSeq) ATP-dependent dethiobiotin synthetase BioD
  KO
K01935  dethiobiotin synthetase [EC:6.3.3.3]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00780  Biotin metabolism
mtu01100  Metabolic pathways
Module
mtu_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Rv1570 (bioD)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.3  dethiobiotin synthase
     Rv1570 (bioD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_26 CbiA DUF1611 ParA CBP_BcsQ
Motif
Other DBs
NCBI-GeneID: 886338
NCBI-ProteinID: NP_216086
TubercuList: Rv1570
UniProt: P9WPQ5 I6XYA5
Structure
PDB: 

Position
1777859..1778539
Genome map
AA seq 226 aa AA seqDB search
MTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDDDLAEVGRLAGVT
QLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADLDRPGRLTLVEGAGGLLVELAEP
GVTLRDVAVDVAAAALVVVTADLGTLNHTKLTLEALAAQQVSCAGLVIGSWPDPPGLVAA
SNRSALARIAMVRAALPAGAASLDAGDFAAMSAAAFDRNWVAGLVG
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
ttgacgatcctggtcgtcaccgggaccggcacgggggtcggcaagacggtcgtctgcgcg
gcgctggcgtcggccgcacgtcaggccggcatcgacgtggcggtgtgcaagcccgttcag
accggcaccgcccgcggtgacgacgacctcgccgaggtcggccggttggccggggtgacc
cagctggccggcttggcgcgatatccgcagccgatggccccggccgccgccgccgaacac
gccgggatggcgttgcccgcccgcgatcagatcgtgcggctgatcgcagacctggaccgt
cccgggcggttgaccctcgtcgagggggcgggcgggctgctggtcgaactcgccgagccg
ggcgtcacgctgcgcgatgtcgccgtcgacgtggccgccgcggctttggtggtggtcacc
gcggacctgggcaccctcaaccacaccaagttgacgttggaagcgcttgctgcacaacag
gtttcatgtgcagggctggtgatcggcagctggccggacccgcccgggttggtggcagcc
tcgaatcggtccgcgctggcgcgcattgctatggtgcgggccgctctgcccgccggggcc
gcgtcgctggatgccggggacttcgcggcgatgagcgcggcggcgttcgaccgcaactgg
gttgccgggctggtcggctga

DBGET integrated database retrieval system