KEGG   Mycobacterium tuberculosis H37Rv: Rv1595Help
Entry
Rv1595            CDS       T00015                                 

Gene name
nadB
Definition
(RefSeq) L-aspartate oxidase
  KO
K00278  L-aspartate oxidase [EC:1.4.3.16]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00250  Alanine, aspartate and glutamate metabolism
mtu00760  Nicotinate and nicotinamide metabolism
mtu01100  Metabolic pathways
Module
mtu_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv1595 (nadB)
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv1595 (nadB)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.16  L-aspartate oxidase
     Rv1595 (nadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 DAO AlaDh_PNT_C HI0933_like FAD_oxidored NAD_binding_8 GIDA Pyr_redox_3 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 886285
NCBI-ProteinID: NP_216111
TubercuList: Rv1595
UniProt: P9WJJ9
Position
1795805..1797388
Genome map
AA seq 527 aa AA seqDB search
MAGPAWRDAADVVVIGTGVAGLAAALAADRAGRSVVVLSKAAQTHVTATHYAQGGIAVVL
PDNDDSVDAHVADTLAAGAGLCDPDAVYSIVADGYRAVTDLVGAGARLDESVPGRWALTR
EGGHSRRRIVHAGGDATGAEVQRALQDAAGMLDIRTGHVALRVLHDGTAVTGLLVVRPDG
CGIISAPSVILATGGLGHLYSATTNPAGSTGDGIALGLWAGVAVSDLEFIQFHPTMLFAG
RAGGRRPLITEAIRGEGAILVDRQGNSITAGVHPMGDLAPRDVVAAAIDARLKATGDPCV
YLDARGIEGFASRFPTVTASCRAAGIDPVRQPIPVVPGAHYSCGGIVTDVYGQTELLGLY
AAGEVARTGLHGANRLASNSLLEGLVVGGRAGKAAAAHAAAAGRSRATSSATWPEPISYT
ALDRGDLQRAMSRDASMYRAAAGLHRLCDSLSGAQVRDVACRRDFEDVALTLVAQSVTAA
ALARTESRGCHHRAEYPCTVPEQARSIVVRGADDANAVCVQALVAVC
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggccggtcccgcttggcgggatgcggccgatgttgtcgtgatcggcacgggcgttgcc
gggctggcggcggcattggccgccgatcgcgccgggcgcagcgtcgtggtgctcagcaag
gctgcccagacgcacgtgaccgcgacacactacgcgcaaggcggtatcgcggtggtgctg
ccggacaacgacgactcggtcgacgctcacgtcgcggacaccttggccgcaggcgcgggc
ctatgcgatcccgatgcggtgtactcgatcgtcgccgacggctaccgagcggttaccgat
ttggtcggagctggggcacggttggatgaatcggtcccgggccgttgggcgttgacgcgc
gaaggcgggcactcgcggcgacgcatcgtgcacgcgggtggcgacgcgaccggcgccgag
gttcagcgggcgctccaggatgccgccgggatgctcgatatccgcaccggccacgtggcg
ttgcgagtgctgcacgacggtaccgcggtgaccgggctattagtggtcagaccggacgga
tgcggcattatcagcgctccgtcggtgatcctggccaccggcgggctcgggcacctgtac
agcgcgaccaccaatccggcgggctccaccggcgacggcatcgccctgggattgtgggcg
ggcgtcgcggtcagcgatctcgagttcatccagttccaccccacgatgctttttgccgga
cgcgccgggggtcggcggccgctgatcaccgaggccatccgcggcgagggtgcgatcttg
gtggacaggcaaggcaattcgataacggcaggcgtgcatccgatgggtgatttggcgccg
cgcgacgtcgtcgccgccgccatcgacgcgcggctgaaggccaccggcgatccgtgcgtc
tacctcgacgcccgcggcatcgagggcttcgcgtcccggttcccgacagtcacggcatcc
tgccgggctgccggcattgaccccgtccggcaaccgatcccggttgttcccggtgcgcac
tacagctgcggcggcatagtgaccgatgtgtacggccagaccgagctgctcgggttgtac
gccgctggcgaggtggcccgcaccgggttgcacggcgccaaccgcctggcctccaacagc
ttgctagagggtttggtggtgggcggccgcgccggaaaggccgccgccgcccacgccgcg
gcggccgggcgttcgcgtgcgacctcgtcagcgacctggcccgaaccgatcagctacacc
gcactggaccgcggcgacctgcaacgggcgatgagccgggacgcgtcgatgtaccgcgcc
gccgccgggctgcaccggctgtgcgacagcctatccggagcacaggttcgcgacgtggct
tgtcgccgcgatttcgaggacgtggcgctcacgctggtcgcgcagagcgtgaccgccgcc
gccttggcccgcaccgaaagccgtggctgccatcatcgcgcggagtacccgtgcaccgtg
ccggagcaggcacgcagcatcgtggtccggggagccgacgacgcaaatgcggtgtgtgtc
caggcgctagtggcggtgtgctga

DBGET integrated database retrieval system