KEGG   Mycobacterium tuberculosis H37Rv: Rv1596Help
Entry
Rv1596            CDS       T00015                                 

Gene name
nadC
Definition
(RefSeq) nicotinate-nucleotide pyrophosphatase
  KO
K00767  nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC:2.4.2.19]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00760  Nicotinate and nicotinamide metabolism
mtu01100  Metabolic pathways
Module
mtu_M00115  NAD biosynthesis, aspartate => NAD
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Rv1596 (nadC)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.19  nicotinate-nucleotide diphosphorylase (carboxylating)
     Rv1596 (nadC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: QRPTase_C QRPTase_N TPR_16
Motif
Other DBs
NCBI-GeneID: 886281
NCBI-ProteinID: NP_216112
TubercuList: Rv1596
UniProt: P9WJJ7 I6XBW1
Structure
PDB: 

Position
1797388..1798245
Genome map
AA seq 285 aa AA seqDB search
MGLSDWELAAARAAIARGLDEDLRYGPDVTTLATVPASATTTASLVTREAGVVAGLDVAL
LTLNEVLGTNGYRVLDRVEDGARVPPGEALMTLEAQTRGLLTAERTMLNLVGHLSGIATA
TAAWVDAVRGTKAKIRDTRKTLPGLRALQKYAVRTGGGVNHRLGLGDAALIKDNHVAAAG
SVVDALRAVRNAAPDLPCEVEVDSLEQLDAVLPEKPELILLDNFAVWQTQTAVQRRDSRA
PTVMLESSGGLSLQTAATYAETGVDYLAVGALTHSVRVLDIGLDM
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggggttatccgactgggagctggctgcggctcgagcagcaatcgcgcgtgggctcgac
gaggacctccggtacggcccggatgtcaccacattggcgacggtgcctgccagtgcgacg
accaccgcatcgctggtgacccgggaggccggtgtggttgccggattggatgtcgcgctg
ctgacgctgaacgaagtcctgggcaccaacggttatcgggtgctcgaccgcgtcgaggac
ggcgcccgggtgccgccgggagaggcacttatgacgctggaagcccaaacgcgcggattg
ttgaccgccgagcgcaccatgttgaacctggtcggtcacctgtcgggaatcgccaccgcg
acggccgcgtgggtcgatgctgtgcgcgggaccaaagcgaaaatccgcgatacccgtaag
acgctgcccggcctgcgcgcgctgcaaaaatacgcggtgcgtaccggtggcggcgtcaac
catcggctggggttgggtgatgccgcgctaatcaaggacaaccacgttgccgccgccgga
tccgtggtagacgcgctacgtgcggtgcgaaatgctgcacccgatctgccgtgcgaggtg
gaagtggactcgcttgagcagctcgatgccgtgctgccggaaaaacccgagctgatcctg
ctggacaattttgcggtgtggcagacgcagaccgcggtgcagcgtcgggactcgcgcgcg
cccaccgtcatgctggagtcatccggtgggctcagcctgcagacggcggcgacctacgcc
gaaaccggggtggactacctggcggtcggggcgctcacacactcagtgcgcgtgctcgac
atcggcttggatatgtag

DBGET integrated database retrieval system