KEGG   Mycobacterium tuberculosis H37Rv: Rv1599Help
Entry
Rv1599            CDS       T00015                                 

Gene name
hisD
Definition
(RefSeq) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00340  Histidine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01230  Biosynthesis of amino acids
Module
mtu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Rv1599 (hisD)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Rv1599 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-GeneID: 886277
NCBI-ProteinID: NP_216115
TubercuList: Rv1599
UniProt: P9WNW9
Position
1799583..1800899
Genome map
AA seq 438 aa AA seqDB search
MLTRIDLRGAELTAAELRAALPRGGADVEAVLPTVRPIVAAVAERGAEAALDFGASFDGV
RPHAIRVPDAALDAALAGLDCDVCEALQVMVERTRAVHSGQRRTDVTTTLGPGATVTERW
VPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVDSLVVASPPQAQWDGMPHPTILAAARL
LGVDEVWAVGGAQAVALLAYGGTDTDGAALTPVDMITGPGNIYVTAAKRLCRSRVGIDAE
AGPTEIAILADHTADPVHVAADLISQAEHDELAASVLVTPSEDLADATDAELAGQLQTTV
HRERVTAALTGRQSAIVLVDDVDAAVLVVNAYAAEHLEIQTADAPQVASRIRSAGAIFVG
PWSPVSLGDYCAGSNHVLPTAGCARHSSGLSVQTFLRGIHVVEYTEAALKDVSGHVITLA
TAEDLPAHGEAVRRRFER
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
gtgcttacccgtatcgacttgcggggagccgagttgacagctgccgagctgcgggccgct
ctgccacgcggcggcgccgatgtggaagccgtgctgccgacggtacggcccattgtggcg
gccgtcgccgagcgcggggccgaggccgcgctggacttcggcgcatcgttcgacggtgtg
cggccccatgccatccgggtgccagacgcagcgctggacgcggcgctggccggactggac
tgcgacgtctgcgaagcgttgcaggtgatggtcgagcggacccgcgccgtgcactccggg
cagcgtcgcaccgacgtcacaaccacactgggcccgggcgcgacggtcaccgagcggtgg
gttccggtcgagcgggtaggcctgtacgtgccggggggcaatgcggtgtacccatccagc
gtggtgatgaacgtggtgcccgcccaagccgcgggcgtcgactcgttggtggtagccagc
ccgccgcaggcgcagtgggatggaatgccgcatccgaccattctggccgcggcccggctg
ctgggcgtcgatgaggtctgggcggtcggcggcgctcaggcggtggcgttgctggcttac
ggcggcaccgacaccgacggcgcagcactgacaccggtcgacatgatcaccgggcctggc
aacatctatgtcacggccgccaagcgactgtgccgttcgcgggtgggcatcgacgccgaa
gcggggccaaccgagatcgctatcctcgccgatcacaccgccgacccggtgcatgtggcc
gccgacctgattagccaggccgaacacgacgagttggctgccagcgtgctggtcactccg
agtgaggacctggccgatgccaccgacgccgaactggctggccagctgcagactacggtg
caccgcgaacgggtgacggccgcgctgaccggacgccaatcggcgatcgtcctggtcgac
gacgtggacgccgccgtcttggtggtgaacgcttacgccgctgagcatttggagattcag
accgccgatgccccgcaggttgccagccggatccgctcggcgggagccattttcgtcggc
ccgtggtccccggtgagcctcggcgactactgcgcgggatccaaccatgtactgccgacc
gcgggctgcgcccggcattccagcggcctgtcggtgcagacgttcctgcgcggcatccac
gtcgtggaatacacggaggcggccctcaaagacgtttccggacacgtgatcacgctcgcc
acggccgaggacttgccggcgcacggtgaggcggtacggcggaggttcgagcgatga

DBGET integrated database retrieval system