KEGG   Mycobacterium tuberculosis H37Rv: Rv1601Help
Entry
Rv1601            CDS       T00015                                 

Gene name
hisB
Definition
(RefSeq) imidazole glycerol-phosphate dehydratase
  KO
K01693  imidazoleglycerol-phosphate dehydratase [EC:4.2.1.19]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00340  Histidine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01230  Biosynthesis of amino acids
Module
mtu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Rv1601 (hisB)
Enzymes [BR:mtu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     Rv1601 (hisB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD Fae
Motif
Other DBs
NCBI-GeneID: 886274
NCBI-ProteinID: NP_216117
TubercuList: Rv1601
UniProt: P9WML9 I6XBW5
Structure
PDB: 

Position
1802035..1802667
Genome map
AA seq 210 aa AA seqDB search
MTTTQTAKASRRARIERRTRESDIVIELDLDGTGQVAVDTGVPFYDHMLTALGSHASFDL
TVRATGDVEIEAHHTIEDTAIALGTALGQALGDKRGIRRFGDAFIPMDETLAHAAVDLSG
RPYCVHTGEPDHLQHTTIAGSSVPYHTVINRHVFESLAANARIALHVRVLYGRDPHHITE
AQYKAVARALRQAVEPDPRVSGVPSTKGAL
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccacccagacagccaaagctagccggcgggcgcgtatcgaacggcgtacccgc
gaatccgatatcgtcatcgagctcgaccttgacggtaccgggcaggtggccgtcgacacc
ggtgttccgttctacgaccacatgttgaccgcgctgggcagtcacgccagcttcgacctc
accgtgcgcgccacaggtgatgtcgaaatcgaagcccatcacaccatcgaggacacggca
atcgcgctgggcaccgcgctcgggcaggccctaggtgacaagaggggcatccgccggttt
ggcgatgccttcatcccgatggacgaaacactggcccacgccgccgtcgacttatccggc
cgcccctattgcgtgcataccggagagccggatcacctgcagcacaccactattgccggc
agttcagtgccctaccacaccgtcatcaaccggcacgtgttcgaatcgttggcggccaac
gcccgcatcgcgctgcacgtccgcgtgttgtacgggcgcgacccgcaccatatcaccgaa
gctcaatacaaggccgtcgcgcgcgcgttgcgtcaagcggtcgagccagatcctcgggtg
tcaggcgtgccgtccaccaaaggtgctctgtga

DBGET integrated database retrieval system