KEGG   Mycobacterium tuberculosis H37Rv: Rv1603Help
Entry
Rv1603            CDS       T00015                                 

Gene name
hisA
Definition
(RefSeq) 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase
  KO
K01814  phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase [EC:5.3.1.16]
K01817  phosphoribosylanthranilate isomerase [EC:5.3.1.24]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00340  Histidine metabolism
mtu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Rv1603 (hisA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv1603 (hisA)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.16  1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino]imidazole-4-carboxamide isomerase
     Rv1603 (hisA)
    5.3.1.24  phosphoribosylanthranilate isomerase
     Rv1603 (hisA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_biosynth NMO Dus IMPDH FMN_dh
Motif
Other DBs
NCBI-GeneID: 885873
NCBI-ProteinID: NP_216119
TubercuList: Rv1603
UniProt: P9WMM5
Structure
PDB: 

Position
1803294..1804031
Genome map
AA seq 245 aa AA seqDB search
MMPLILLPAVDVVEGRAVRLVQGKAGSQTEYGSAVDAALGWQRDGAEWIHLVDLDAAFGR
GSNHELLAEVVGKLDVQVELSGGIRDDESLAAALATGCARVNVGTAALENPQWCARVIGE
HGDQVAVGLDVQIIDGEHRLRGRGWETDGGDLWDVLERLDSEGCSRFVVTDITKDGTLGG
PNLDLLAGVADRTDAPVIASGGVSSLDDLRAIATLTHRGVEGAIVGKALYARRFTLPQAL
AAVRD
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgatgccgctgatacttttgcccgccgtcgacgtggtcgagggtcgtgccgtgcgcctc
gttcaagggaaggccggcagccaaaccgagtacggctcagcggtggatgccgcgttgggc
tggcaacgcgatggcgccgagtggatccatttggtggacctggatgctgcgttcggccgc
ggttccaaccacgaactgcttgccgaggttgtcggcaagctcgacgtacaggttgagcta
tccggcggtattcgagacgacgagtcgctggccgcggcgctggccaccggatgcgctcgg
gtcaatgtgggcactgctgccctggaaaacccgcagtggtgtgcccgggtgattggcgag
cacggcgaccaggtcgccgtcggcttggacgtccagatcatcgacggcgagcatcggttg
cgcggacgcggctgggaaaccgacggcggcgacctgtgggacgtgctagaacgcctagac
agtgaaggatgttcgcggttcgtcgtgaccgatatcaccaaggacggcaccctgggcggc
cccaatctggacctgctggccggtgttgccgaccgcaccgacgccccggtgatcgcgtcc
ggaggtgtgtccagcctcgatgacctgcgcgccattgcgactctcacgcaccgcggcgtc
gagggggccatcgtcggcaaggccctctacgcccgtcggttcaccttgccgcaagcgttg
gccgcggttcgggactag

DBGET integrated database retrieval system