KEGG   Mycobacterium tuberculosis H37Rv: Rv1609Help
Entry
Rv1609            CDS       T00015                                 

Gene name
trpE
Definition
(RefSeq) anthranilate synthase component I
  KO
K01657  anthranilate synthase component I [EC:4.1.3.27]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
mtu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv1609 (trpE)
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    Rv1609 (trpE)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rv1609 (trpE)
Enzymes [BR:mtu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     Rv1609 (trpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Chorismate_bind Anth_synt_I_N
Motif
Other DBs
NCBI-GeneID: 885040
NCBI-ProteinID: NP_216125
TubercuList: Rv1609
UniProt: P9WFX3 I6Y6Z9
Structure
PDB: 

Position
1807903..1809453
Genome map
AA seq 516 aa AA seqDB search
MHADLAATTSREDFRLLAAEHRVVPVTRKVLADSETPLSAYRKLAANRPGTFLLESAENG
RSWSRWSFIGAGAPTALTVREGQAVWLGAVPKDAPTGGDPLRALQVTLELLATADRQSEP
GLPPLSGGMVGFFAYDMVRRLERLPERAVDDLCLPDMLLLLATDVAAVDHHEGTITLIAN
AVNWNGTDERVDWAYDDAVARLDVMTAALGQPLPSTVATFSRPEPRHRAQRTVEEYGAIV
EYLVDQIAAGEAFQVVPSQRFEMDTDVDPIDVYRILRVTNPSPYMYLLQVPNSDGAVDFS
IVGSSPEALVTVHEGWATTHPIAGTRWRGRTDDEDVLLEKELLADDKERAEHLMLVDLGR
NDLGRVCTPGTVRVEDYSHIERYSHVMHLVSTVTGKLGEGRTALDAVTACFPAGTLSGAP
KVRAMELIEEVEKTRRGLYGGVVGYLDFAGNADFAIAIRTALMRNGTAYVQAGGGVVADS
NGSYEYNEARNKARAVLNAIAAAETLAAPGANRSGC
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
gtgcacgccgacctcgcagccaccacctcgcgtgaggatttccgcctcctggcggccgag
caccgggtggttccggtgactcgcaaggtcttggccgacagcgagacgccgctgtcggcc
taccgcaagctcgccgccaatcgcccgggtacgttcctgctggagtcggccgagaacggc
cggtcgtggtcgcgatggtcgtttatcggtgcgggggcgccaacggcgttgaccgtgcgt
gaggggcaagcggtatggctgggtgccgtgcccaaggacgctcccactggcggagacccg
ctgcgggcgctgcaggtgaccttggagctgctggctacggcggatcgtcagtccgagccg
ggtcttccgccgctgtcgggtggcatggtcggtttcttcgcctatgacatggtgcgacgg
ctggaacgattgccggaacgggccgtcgatgacctctgcctgccggacatgctgctgttg
ctggccaccgatgtggcggcggtcgatcaccacgagggcaccatcacgttgatcgccaac
gccgtgaactggaacggcaccgacgagcgggtcgactgggcctacgacgacgcggtcgct
cggctggacgtgatgaccgcagcgctcggccaaccactaccgtcaaccgtggccaccttc
agccgacccgagccgcgccaccgtgcgcaacgcaccgtcgaagaatatggtgcgatcgtc
gaatacttggtggatcagattgcagccggtgaagcgttccaggtggtgccctcgcagcgc
ttcgagatggacaccgatgtcgatcccatcgacgtgtaccgaattctgcgggtaaccaac
ccaagtccctacatgtatctactgcaggtgccgaatagtgatggtgcagtggacttttcg
attgttggatccagtccggaggcgctggtaacggtccacgaaggctgggcgacgacgcat
ccgatcgccggaacccggtggcgcggaaggacagacgacgaggacgtgcttctggaaaaa
gagctgctggcggacgacaaagaacgtgccgagcatctgatgctggtcgacctcggccga
aacgacctgggtcgggtctgcacgccgggcactgttcgggtcgaggattacagccacatc
gagcggtacagccacgtgatgcacctggtgtccacggtgaccgggaagctcggcgaaggg
cgcaccgcgctggacgcggtgaccgcctgctttccggccggcacgctgtcgggcgcgccg
aaggtgcgggcgatggagctgatcgaagaggtggagaagacacgccgcggcctttacggc
ggtgtcgtcggttaccttgacttcgccggcaacgctgacttcgccatcgccatccgcacc
gcgctgatgcgtaacggcacggcttatgtccaggcaggcggtggtgtggtggccgactcc
aacggatcctacgaatacaacgaggcgaggaacaaggctcgggctgtgctcaacgcgatc
gctgccgccgagacgctggccgctccgggcgcgaaccgcagtggctgctaa

DBGET integrated database retrieval system