KEGG   Mycobacterium tuberculosis H37Rv: Rv1617Help
Entry
Rv1617            CDS       T00015                                 

Gene name
pykA
Definition
(RefSeq) pyruvate kinase
  KO
K00873  pyruvate kinase [EC:2.7.1.40]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00230  Purine metabolism
mtu00620  Pyruvate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mtu_M00002  Glycolysis, core module involving three-carbon compounds
mtu_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
mtu_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv1617 (pykA)
   00620 Pyruvate metabolism
    Rv1617 (pykA)
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv1617 (pykA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mtu04131]
    Rv1617 (pykA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv1617 (pykA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.40  pyruvate kinase
     Rv1617 (pykA)
Membrane trafficking [BR:mtu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Rv1617 (pykA)
Exosome [BR:mtu04147]
 Exosomal proteins
  Proteins found in most exosomes
   Rv1617 (pykA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PK PK_C HpcH_HpaI
Motif
Other DBs
NCBI-GeneID: 885501
NCBI-ProteinID: NP_216133
TubercuList: Rv1617
UniProt: P9WKE5 I6YB35
Structure
PDB: 

Position
1816189..1817607
Genome map
AA seq 472 aa AA seqDB search
MTRRGKIVCTLGPATQRDDLVRALVEAGMDVARMNFSHGDYDDHKVAYERVRVASDATGR
AVGVLADLQGPKIRLGRFASGATHWAEGETVRITVGACEGSHDRVSTTYKRLAQDAVAGD
RVLVDDGKVALVVDAVEGDDVVCTVVEGGPVSDNKGISLPGMNVTAPALSEKDIEDLTFA
LNLGVDMVALSFVRSPADVELVHEVMDRIGRRVPVIAKLEKPEAIDNLEAIVLAFDAVMV
ARGDLGVELPLEEVPLVQKRAIQMARENAKPVIVATQMLDSMIENSRPTRAEASDVANAV
LDGADALMLSGETSVGKYPLAAVRTMSRIICAVEENSTAAPPLTHIPRTKRGVISYAARD
IGERLDAKALVAFTQSGDTVRRLARLHTPLPLLAFTAWPEVRSQLAMTWGTETFIVPKMQ
STDGMIRQVDKSLLELARYKRGDLVVIVAGAPPGTVGSTNLIHVHRIGEDDV
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagacgcgggaaaatcgtctgcactctcgggccggccacccagcgggacgacctg
gtcagagcgctggtcgaggccggaatggacgtcgcccgaatgaacttcagccacggcgac
tacgacgatcacaaggtcgcctatgagcgggtccgggtagcctccgacgccaccgggcgc
gcggtcggcgtgctcgccgacctgcagggcccgaagatcaggttgggacgcttcgcctcc
ggggccacccactgggccgaaggcgaaaccgtccggatcaccgtgggcgcctgcgagggc
agccacgatcgggtgtccaccacctacaagcggctagcccaggacgcggtggccggtgac
cgggtgctggtcgacgacggcaaagtcgcattggtggtcgacgccgtcgagggcgacgac
gtggtctgcaccgtcgtcgaaggcggcccggtcagcgacaacaagggcatctcgttgccc
ggaatgaacgtgaccgcgccggccctgtcggagaaggacatcgaggatctcacgttcgcg
ctgaacctcggcgtcgacatggtggcgctttccttcgtccgctccccggccgatgtcgaa
ctggtccacgaggtgatggatcggatcgggcgacgggtgccggtgatcgccaagctggag
aagccggaagccatcgacaatctcgaagcgatcgtgctggcgttcgacgccgtcatggtc
gctcggggcgacctaggtgttgagctgccgctcgaagaggtcccgctggtacagaagcga
gccatccagatggcccgggagaacgccaagccggtcattgtggcgacccagatgctcgac
tcgatgatcgagaactcgcggccgacccgagctgaggcctccgacgtcgccaacgcggtg
ctcgatggcgccgacgcgctgatgctgtccggggaaacctcggtagggaagtaccccctt
gctgcggtccggacaatgtcgcgcatcatctgcgcggtcgaggagaactccacggccgca
ccgccgttgacacacattccccggaccaagcgtggggtcatctcgtatgcggcccgtgac
atcggcgaacgactcgacgccaaggccttggtggccttcactcagtccggtgataccgtg
cggcgactggcccgcctgcataccccgctgccgctgctggccttcaccgcgtggcccgag
gtgcgcagccaactggcgatgacctggggcaccgagacgttcatcgtgccgaagatgcag
tccaccgatggcatgatccgccaggtcgacaaatcgctgctcgaactcgcccgctacaag
cgtggtgacttggtggtcatcgtcgcgggtgcgccgccaggcacagtgggttcgaccaac
ctgatccacgtgcaccggatcggggaagatgacgtctag

DBGET integrated database retrieval system