KEGG   Mycobacterium tuberculosis H37Rv: Rv1653Help
Entry
Rv1653            CDS       T00015                                 

Gene name
argJ
Definition
(RefSeq) bifunctional glutamate N-acetyltransferase/amino-acid acetyltransferase
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00220  Arginine biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Rv1653 (argJ)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     Rv1653 (argJ)
    2.3.1.35  glutamate N-acetyltransferase
     Rv1653 (argJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ArgJ
Motif
Other DBs
NCBI-GeneID: 885125
NCBI-ProteinID: NP_216169
TubercuList: Rv1653
UniProt: P9WPZ3 I6XYJ7
Structure
PDB: 

Position
1866631..1867845
Genome map
AA seq 404 aa AA seqDB search
MTDLAGTTRLLRAQGVTAPAGFRAAGVAAGIKASGALDLALVFNEGPDYAAAGVFTRNQV
KAAPVLWTQQVLTTGRLRAVILNSGGANACTGPAGFADTHATAEAVAAALSDWGTETGAI
EVAVCSTGLIGDRLPMDKLLAGVAHVVHEMHGGLVGGDEAAHAIMTTDNVPKQVALHHHD
NWTVGGMAKGAGMLAPSLATMLCVLTTDAAAEPAALERALRRAAAATFDRLDIDGSCSTN
DTVLLLSSGASEIPPAQADLDEAVLRVCDDLCAQLQADAEGVTKRVTVTVTGAATEDDAL
VAARQIARDSLVKTALFGSDPNWGRVLAAVGMAPITLDPDRISVSFNGAAVCVHGVGAPG
AREVDLSDADIDITVDLGVGDGQARIRTTDLSHAYVEENSAYSS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacctggccggcaccacccggctgctgcgcgctcagggcgtcaccgccccggcc
ggctttcgggccgccggcgtcgccgccgggatcaaggcctccggtgcgctggatctggcg
ctggtgttcaacgagggacccgactacgccgccgccggggtgttcacccgcaaccaggtc
aaggcggcgccggtgctgtggacccagcaagtgctgaccaccgggcggctgcgcgcggtg
atcctcaactccggcggcgccaatgcctgcaccgggccggccggcttcgccgacacccac
gccaccgcggaggcggtggccgcggcgttgtcggactggggaaccgagaccggggccatc
gaggtcgccgtctgctccaccgggctgatcggcgaccggctgccgatggacaagctgctc
gccggcgtcgcccacgtggtgcacgagatgcatggcgggctggtcggcggcgatgaagcc
gcccacgccatcatgaccaccgacaacgtgcccaaacaggttgcgctgcaccatcacgac
aactggacggtcggcggcatggccaaaggcgcgggcatgctggcgccgtcgttggccacc
atgctgtgcgtgctcaccaccgacgcggccgccgagccggccgcactcgagcgggcgctg
cgccgcgccgccgcggccacgttcgaccggctcgacatcgacggcagctgctccaccaac
gacaccgtgctgctgctgtcgtccggggccagtgaaatcccccctgcccaggccgatctc
gacgaggccgtgctacgggtctgcgacgatttgtgcgcccagctgcaggccgacgccgaa
ggcgtcaccaaacgcgtcaccgtgaccgtgaccggggccgccaccgaagacgacgcgctg
gtcgccgcccgccagatcgcccgcgacagcctggtcaagaccgcgctgttcgggtccgac
ccgaactggggacgggtgctcgccgccgtcgggatggcaccgatcaccctcgacccggat
cgaatcagcgtgtcgttcaacggtgccgcggtgtgtgtgcacggtgtcggcgctcccggt
gcgcgcgaggtggacctgtcggacgcggacatcgatatcaccgtcgacctcggcgtcggc
gacgggcaggcgaggatccgaaccactgatctgtcgcatgcctacgtcgaagagaactcg
gcctacagctcatga

DBGET integrated database retrieval system