KEGG   Mycobacterium tuberculosis H37Rv: Rv1654Help
Entry
Rv1654            CDS       T00015                                 

Gene name
argB
Definition
(RefSeq) acetylglutamate kinase
  KO
K00930  acetylglutamate kinase [EC:2.7.2.8]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00220  Arginine biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Rv1654 (argB)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.8  acetylglutamate kinase
     Rv1654 (argB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-GeneID: 888076
NCBI-ProteinID: NP_216170
TubercuList: Rv1654
UniProt: P9WQ01 I6XC17
Structure
PDB: 

Position
1867842..1868726
Genome map
AA seq 294 aa AA seqDB search
MSRIEALPTHIKAQVLAEALPWLKQLHGKVVVVKYGGNAMTDDTLRRAFAADMAFLRNCG
IHPVVVHGGGPQITAMLRRLGIEGDFKGGFRVTTPEVLDVARMVLFGQVGRELVNLINAH
GPYAVGITGEDAQLFTAVRRSVTVDGVATDIGLVGDVDQVNTAAMLDLVAAGRIPVVSTL
APDADGVVHNINADTAAAAVAEALGAEKLLMLTDIDGLYTRWPDRDSLVSEIDTGTLAQL
LPTLESGMVPKVEACLRAVIGGVPSAHIIDGRVTHCVLVELFTDAGTGTKVVRG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcgaagcactgcccacccacatcaaagcgcaggtgctggccgaggccctg
ccctggctcaagcagttgcacggcaaggtcgtcgtcgtcaaatacggcggcaacgcgatg
accgacgacacgctgcggcgcgcgttcgccgccgacatggcgtttctgcgcaactgcggc
atccatcccgtcgtggtgcacggcggggggccgcagatcaccgccatgctgcggcggctc
ggcatcgagggcgacttcaagggcggattccgggtcaccacacccgaagtgctcgacgtg
gcccggatggtgctgttcggtcaggtgggccgggaactggtcaacctgatcaacgcgcac
ggaccgtatgccgtcgggatcaccggcgaggacgcgcagctgttcaccgccgtgcggcgc
agcgtcaccgtcgacggcgtggccaccgacatcggcctggtcggcgacgtcgaccaggtg
aacaccgcggcaatgctggatctggttgcggcgggccggatcccggtggtgtccacgctg
gccccggatgccgacggcgtggtgcacaacatcaacgccgacaccgccgccgcggcggtc
gccgaagccctgggcgccgaaaagctgttgatgctcaccgatatcgacggcctgtacacc
cgctggccggatcgcgactcgctggtcagcgagatcgacaccggcacactggcgcaactg
ctgccgacgctggaatcgggcatggtccccaaggtcgaagcgtgcctgcgggcggtcatc
ggcggggtgcccagcgcgcacatcatcgatgggcgggtcacacactgcgtgttggtggag
ttgttcaccgacgcgggcaccggcaccaaggtggtgcgcggatga

DBGET integrated database retrieval system