KEGG   Mycobacterium tuberculosis H37Rv: Rv1655Help
Entry
Rv1655            CDS       T00015                                 

Gene name
argD
Definition
(RefSeq) acetylornithine aminotransferase
  KO
K00821  acetylornithine/N-succinyldiaminopimelate aminotransferase [EC:2.6.1.11 2.6.1.17]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00220  Arginine biosynthesis
mtu00300  Lysine biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
mtu_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Rv1655 (argD)
   00220 Arginine biosynthesis
    Rv1655 (argD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtu01007]
    Rv1655 (argD)
Enzymes [BR:mtu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.11  acetylornithine transaminase
     Rv1655 (argD)
    2.6.1.17  succinyldiaminopimelate transaminase
     Rv1655 (argD)
Amino acid related enzymes [BR:mtu01007]
 Aminotransferase (transaminase)
  Class III
   Rv1655 (argD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 885187
NCBI-ProteinID: NP_216171
TubercuList: Rv1655
UniProt: P9WPZ7 I6YB71
Position
1868723..1869925
Genome map
AA seq 400 aa AA seqDB search
MTGASTTTATMRQRWQAVMMNNYGTPPIALASGDGAVVTDVDGRTYIDLLGGIAVNVLGH
RHPAVIEAVTRQMSTLGHTSNLYATEPGIALAEELVALLGADQRTRVFFCNSGAEANEAA
FKLSRLTGRTKLVAAHDAFHGRTMGSLALTGQPAKQTPFAPLPGDVTHVGYGDVDALAAA
VDDHTAAVFLEPIMGESGVVVPPAGYLAAARDITARRGALLVLDEVQTGMGRTGAFFAHQ
HDGITPDVVTLAKGLGGGLPIGACLAVGPAAELLTPGLHGSTFGGNPVCAAAALAVLRVL
ASDGLVRRAEVLGKSLRHGIEALGHPLIDHVRGRGLLLGIALTAPHAKDAEATARDAGYL
VNAAAPDVIRLAPPLIIAEAQLDGFVAALPAILDRAVGAP
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcgcttcgaccacgacggcgaccatgcggcagcggtggcaagccgtgatgatg
aacaactacggcacccccccgatagcgctggccagcggtgacggcgccgtggtcaccgac
gtggacggcagaacctatatcgacctgctcggcggcatcgcggtcaacgtgctgggccat
cgccaccccgcggtcatcgaggccgtcacccggcagatgtcgacgctggggcacacctcc
aacctgtatgccaccgaaccgggcatcgcgctggccgaggagctggtcgcgctgctgggg
gccgaccagcggacgcgagtgttcttctgcaactccggcgccgaggccaacgaggcggcg
ttcaagctgtctcggctcaccggacgcacgaaactggtcgccgcccacgacgccttccac
ggccgcaccatgggctcgctggcgctcaccggacaaccggccaagcaaacgccgttcgcg
ccgctgcccggcgacgtcacgcacgtcggctacggcgacgtcgacgcgttggccgccgcc
gtcgatgaccacaccgccgcggtgttcctggaaccgatcatgggggagagcggggtcgtc
gtcccgcccgcgggctaccttgccgccgcccgcgacatcacggcgcggcgcggcgcgctg
ctggtgctcgacgaggtgcaaaccgggatgggccgcaccggagcgttcttcgcccaccag
cacgacggcatcaccccggacgtggtgaccctggccaagggtctgggcggcgggctgccg
atcggtgcctgcctggccgtcgggccggccgccgaactactgaccccaggcctgcacggc
agcaccttcggcggcaacccggtctgcgccgcggcggcgctggcggtgctacgggtgctg
gcgagcgacggcctggtccgccgcgccgaagtcttgggcaaatcgttgcggcacggcatc
gaagcgctcggccacccgctcatcgaccacgtgcgcggacgcggactgctgttgggcatc
gcgctgaccgccccgcacgccaaggacgccgaggccaccgcccgcgacgccggttacctg
gtcaacgcggccgcacccgacgtcatccggttggcgccgccgctgatcatcgccgaagca
cagctcgacggctttgtcgccgccttgccggcaatcctggaccgcgccgtgggggccccg
tga

DBGET integrated database retrieval system