KEGG   Mycobacterium tuberculosis H37Rv: Rv1659Help
Entry
Rv1659            CDS       T00015                                 

Gene name
argH
Definition
(RefSeq) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00220  Arginine biosynthesis
mtu00250  Alanine, aspartate and glutamate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Module
mtu_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv1659 (argH)
   00220 Arginine biosynthesis
    Rv1659 (argH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mtu04147]
    Rv1659 (argH)
Enzymes [BR:mtu01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     Rv1659 (argH)
Exosome [BR:mtu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Rv1659 (argH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 ASL_C2
Motif
Other DBs
NCBI-GeneID: 885365
NCBI-ProteinID: NP_216175
TubercuList: Rv1659
UniProt: P9WPY7 I6XC24
Position
1872639..1874051
Genome map
AA seq 470 aa AA seqDB search
MSTNEGSLWGGRFAGGPSDALAALSKSTHFDWVLAPYDLTASRAHTMVLFRAGLLTEEQR
DGLLAGLDSLAQDVADGSFGPLVTDEDVHAALERGLIDRVGPDLGGRLRAGRSRNDQVAA
LFRMWLRDAVRRVATGVLDVVGALAEQAAAHPSAIMPGKTHLQSAQPILLAHHLLAHAHP
LLRDLDRIVDFDKRAAVSPYGSGALAGSSLGLDPDAIAADLGFSAAADNSVDATAARDFA
AEAAFVFAMIAVDLSRLAEDIIVWSSTEFGYVTLHDSWSTGSSIMPQKKNPDIAELARGK
SGRLIGNLAGLLATLKAQPLAYNRDLQEDKEPVFDSVAQLELLLPAMAGLVASLTFNVQR
MAELAPAGYTLATDLAEWLVRQGVPFRSAHEAAGAAVRAAEQRGVGLQELTDDELAAISP
ELTPQVREVLTIEGSVSARDCRGGTAPGRVAEQLNAIGEAAERLRRQLVR
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgagcaccaacgaggggtcgctgtggggcgggcggttcgccggcggcccgtccgacgcg
ctggccgcgctgagcaagtccacccacttcgactgggtgctggccccctacgacctcacc
gcgtcgcgggcgcacaccatggtgctgtttcgggccgggctgctcaccgaggagcaacgc
gacgggctgctcgccggcctggacagcctcgcccaagacgtcgccgacggcagcttcggc
ccgctggtcaccgacgaggacgtgcatgccgcgctggagcggggcctgatcgaccgggtc
ggaccggacctgggcggccgactgcgggccgggcgctcgcgcaacgaccaggtggccgcg
ctgtttcggatgtggctgcgcgacgcggtgcgccgggtcgccaccggtgtgctcgacgtg
gtcggtgcgctggcagagcaggccgccgcacacccgagcgccatcatgcccggcaaaacc
cacctgcagtccgcccagccgatcctgctggcacaccatctgctcgcgcacgcccacccc
ctgctgcgcgacctggaccgcatcgtcgacttcgacaaacgcgcggcggtgtccccgtac
ggctcgggcgccttggccggctcgtcgctgggcctggatcccgacgcgatcgccgcggac
ctcggtttctcggctgccgcggacaactccgtcgacgcgaccgccgcccgcgacttcgcc
gccgaggcggcgttcgtgttcgccatgatcgccgtcgacctgtcccggctggctgaggac
atcatcgtctggagctcgacggaattcggctacgtcacgttgcatgactcgtggtccacc
ggtagctcgatcatgccgcagaagaagaatccggacatcgccgagctggcccgcggcaag
tccgggcggctgatcggaaacctggccgggctgctggccaccctgaaagcccagcccctg
gcctacaaccgcgacctgcaggaagacaaggagccggtgttcgattcggtggcccagctg
gagctgctgctgccggcgatggccgggctggtggccagcctgaccttcaatgtccagcgg
atggcggagctggccccggccggctatacgttggccaccgatctcgccgaatggcttgtg
cggcaaggtgttccgtttaggtccgcgcatgaggccgcgggtgcggcggtgcgtgcggcc
gaacagcgcggcgtggggctgcaggaactcaccgacgacgagctggccgccatcagcccc
gagctgaccccgcaagtccgcgaggtgctgaccatcgaaggctcggtgtcggcccgcgat
tgccggggtggcaccgcgccgggccgggttgccgagcaactgaacgccattggtgaagcc
gccgagcggctgcgccgccagctggtgcgctga

DBGET integrated database retrieval system