KEGG   Mycobacterium tuberculosis H37Rv: Rv1811Help
Entry
Rv1811            CDS       T00015                                 

Gene name
mgtC
Definition
(RefSeq) Mg2+ transport P-type ATPase MgtC
  KO
K07507  putative Mg2+ transporter-C (MgtC) family protein
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mtu02000]
    Rv1811 (mgtC)
Transporters [BR:mtu02000]
 Other Transporters
  Others
   Rv1811 (mgtC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MgtC
Motif
Other DBs
NCBI-GeneID: 885439
NCBI-ProteinID: NP_216327
TubercuList: Rv1811
UniProt: A0A089QQE5 I6YBN6
Structure
PDB: 

Position
2053443..2054147
Genome map
AA seq 234 aa AA seqDB search
MQTLTVADFALRLAVGVGCGAIIGLERQWRARMAGLRTNALVATGATLFVLYAVATEDSS
PTRVASYVVSGIGFLGGGVILREGFNVRGLNTAATLWCSAAVGVLAASGHLVFTLIGTGT
IVAVHLLGRPLGRLVDRDNAVEDEGLQPYQVRVICRPKAETYVRAHIVQRTSSNDITLRG
IRTGPAGDDNITLTAHLLMVGHTPAKLERLVAELSLQPGVYAVHWYAGEHAQAE
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacgctgactgtcgccgatttcgctctccggctggccgtcggagtgggttgcggg
gccattatcgggctcgagcgccagtggcgggcgcggatggctgggttgcgcaccaacgct
ctggtggcgaccggtgctaccttgttcgtgctgtacgcggtcgccaccgaggacagcagc
cccacccgagtggcgtcctacgtggtttctggaattggattcctgggcggcggggtcatc
ctgcgggaggggttcaacgtccgcggtctgaacacggctgccacgctttggtgctcggcc
gcggtcggagtgctggccgcctccgggcatctggtgttcaccctgattggcaccggaacc
atcgtcgctgtccatctcctggggcgcccacttggccggctggtcgaccgcgacaacgcc
gtcgaagacgaagggctgcagccctaccaggtacgggtgatttgtcggcccaaagcagag
acctatgtacgtgcccatatcgtgcagcgcaccagcagcaacgacatcacgctgcggggt
atacgcacggggccggccggagacgacaacatcacgttgacggcccacctattgatggtt
ggccataccccggccaagctagagcggttggtggcggaactgtcgctgcagccgggcgtt
tacgctgtgcactggtatgccggtgagcacgcgcaggccgaatga

DBGET integrated database retrieval system