KEGG   Mycobacterium tuberculosis H37Rv: Rv1850Help
Entry
Rv1850            CDS       T00015                                 

Gene name
ureC
Definition
(RefSeq) urease subunit alpha
  KO
K01428  urease subunit alpha [EC:3.5.1.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00220  Arginine biosynthesis
mtu00230  Purine metabolism
mtu01100  Metabolic pathways
mtu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rv1850 (ureC)
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Rv1850 (ureC)
  09111 Xenobiotics biodegradation and metabolism
   00791 Atrazine degradation
    Rv1850 (ureC)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.5  urease
     Rv1850 (ureC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Urease_alpha Amidohydro_3
Motif
Other DBs
NCBI-GeneID: 885359
NCBI-ProteinID: NP_216366
TubercuList: Rv1850
UniProt: P9WFF1 I6XCN3
Position
2097961..2099694
Genome map
AA seq 577 aa AA seqDB search
MARLSRERYAQLYGPTTGDRIRLADTNLLVEVTEDRCGGPGLAGDEAVFGGGKVLRESMG
QGRASRADGAPDTVITGAVIIDYWGIIKADIGIRDGRIVGIGKAGNPDIMTGVHRDLVVG
PSTEIISGNRRIVTAGTVDCHVHLICPQIIVEALAAGTTTIIGGGTGPAEGTKATTVTPG
EWHLARMLESLDGWPVNFALLGKGNTVNPDALWEQLRGGASGFKLHEDWGSTPAAIDTCL
AVADVAGVQVALHSDTLNETGFVEDTIGAIAGRSIHAYHTEGAGGGHAPDIITVAAQPNV
LPSSTNPTRPHTVNTLDEHLDMLMVCHHLNPRIPEDLAFAESRIRPSTIAAEDVLHDMGA
ISMIGSDSQAMGRVGEVVLRTWQTAHVMKARRGALEGDPSGSQAADNNRVRRYIAKYTIC
PAIAHGMDHLIGSVEVGKLADLVLWEPAFFGVRPHVVLKGGAIAWAAMGDANASIPTPQP
VLPRPMFGAAAATAAATSVHFVAPQSIDARLADRLAVNRGLAPVADVRAVGKTDLPLNDA
LPSIEVDPDTFTVRIDGQVWQPQPAAELPMTQRYFLF
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgactgtcaagggagcgctacgcacagctgtacggacctaccaccggcgaccgg
atacggctggccgacaccaacctgctggttgaggtcaccgaagaccggtgtgggggaccg
ggactggccggtgacgaggcggtgttcggcggcggcaaggtgctgcgcgagtccatgggc
cagggccgtgcgagccgggccgacggtgcccccgacaccgtgatcaccggtgcggtgatc
atcgactactggggaatcatcaaggccgacatcgggattcgcgatggccgcatcgtcggg
atcggaaaggccggcaatcccgacatcatgacaggtgtgcatcgggatctcgtcgtcggg
ccgtccaccgaaatcatcagcggcaaccgtcgaatcgtcaccgcaggcaccgtcgactgt
cacgtgcacttgatctgtccgcagatcatcgtcgaagccttggccgcgggcaccaccacg
atcatcggcggtggcaccggacccgccgagggcaccaaggccaccacagtcactcccggc
gagtggcacctggcccggatgctggagtcactggacggttggccggtgaacttcgcgctg
ctcggcaagggaaacaccgtgaatcccgacgcactgtgggaacagttgcgcggtggcgca
tcgggtttcaaactccacgaagactggggatcgaccccggcggccatcgacacctgcttg
gcggtcgccgacgtggccggggtgcaggttgcgctgcactccgacactctcaatgagacc
ggattcgtcgaggacaccatcggcgcgatcgccggacgttcgattcacgcctaccacacc
gagggcgccggcggcgggcacgcaccggacatcattaccgtcgcggcgcaaccgaatgta
ctgcccagctcgaccaatccgacccgcccgcatacggtgaacacccttgacgagcatctc
gacatgctgatggtgtgccaccacctcaacccccggatcccggaggacctcgcgtttgcc
gaaagccggatccgaccgtccaccattgcggcagaagatgtgttgcacgatatgggggca
atctcgatgattggcagcgattcccaggcgatgggccgtgtcggcgaggtggtgctgcgc
acctggcagaccgcgcacgtgatgaaagcccgccgcggggcactggaaggtgacccgtct
ggtagccaagccgccgacaacaaccgggtccgccgctacatcgccaaatacaccatctgc
ccggccatcgcacacggcatggatcacctgatcggttcggtggaggtgggaaagttggcc
gacctggtgttgtgggagccggcgtttttcggggttcgcccgcacgtcgtgctcaaaggt
ggggcgatcgcctgggcagcgatgggcgatgcgaacgcgtcaatcccgaccccgcaaccg
gtgctcccgcgaccgatgttcggcgcggccgcggcaaccgcggcggcgacctcggtgcac
ttcgtcgcgccgcaatccatcgacgcgcgcctggcggaccggctcgcggtcaatcgggga
ctagcgccggtggccgacgtgcgcgcagtgggcaagaccgacctgccgctcaatgatgcc
ctaccgagcatcgaggtcgatcccgacaccttcaccgtgcgaatcgacggccaggtgtgg
caaccgcagccggccgccgaactacctatgacacaacggtatttcctgttctaa

DBGET integrated database retrieval system