KEGG   Mycobacterium tuberculosis H37Rv: Rv1862Help
Entry
Rv1862            CDS       T00015                                 

Gene name
adhA
Definition
(RefSeq) alcohol dehydrogenase A
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00071  Fatty acid degradation
mtu00350  Tyrosine metabolism
mtu00625  Chloroalkane and chloroalkene degradation
mtu00626  Naphthalene degradation
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv1862 (adhA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Rv1862 (adhA)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Rv1862 (adhA)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Rv1862 (adhA)
   00626 Naphthalene degradation
    Rv1862 (adhA)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Rv1862 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-GeneID: 885652
NCBI-ProteinID: NP_216378
TubercuList: Rv1862
UniProt: P9WQC1 I6X2I0
Position
2109544..2110584
Genome map
AA seq 346 aa AA seqDB search
MVSPATTATMSAWQVRRPGPMDTGPLERVTTRVPRPAPSELLVAVHACGVCRTDLHVTEG
DLPVHRERVIPGHEVVGEVIEVGSAVGAAAGGEFDRGDRVGIAWLRHTCGVCKYCRRGSE
NLCPQSRYTGWDADGGYAEFTTVPAAFAHHLPSGYSDSELAPLLCAGIIGYRSLLRTELP
PGGRLGLYGFGGSAHITAQVALAQGAEIHVMTRGARARKLALQLGAASAQDAADRPPVPL
DAAILFAPVGDLVLPALEALDRGGILAIAGIHLTDIPDLNYQQHLFQERQIRSVTSNTRA
DARAFFDFAAQHHIEVTTPEYPLGQADRALGDLSAGRIAGAAVLLI
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggtctcaccggcgaccacggcgacgatgagtgcgtggcaggtgcgtcggcccggcccg
atggacaccggcccgctcgaacgagtgaccacccgggtgccgcgcccggcgccatcggag
ttgctggtggccgtgcacgcatgcggggtgtgccgcaccgatctccacgtgaccgaaggt
gacctgcccgtgcaccgcgaacgggtgattcccggccacgaggtagtgggagaggtcatt
gaggtgggctcagcggtgggcgcggctgccggtggcgaattcgaccgaggagaccgggtg
ggtatcgcctggctgcgtcacacttgcggggtctgcaagtactgccggcgcggcagcgag
aacctctgcccgcaatcccgctacaccggctgggacgccgacgggggatacgccgaattc
acgacggttcctgcggctttcgcgcaccatctgccgagcggctatagcgacagcgagctg
gcgccgttgttgtgcgccggcatcatcggatatcgatcgctgctgcgcaccgagctacca
cccggtggccggctgggtctctacggattcggcggcagtgcccacatcaccgcccaggtc
gcgttggcgcaaggcgccgaaatacatgtgatgacacgcggggcccgcgcgcgcaagctg
gcgctgcaacttggcgctgcatcggctcaggacgccgccgaccggccacccgtgccgctg
gacgccgcgatcttattcgccccggtcggggatctggtgctgcccgcgctggaagcgctg
gaccgtggcggcatcttggcgatcgccgggatccacctgacagatattccggacctgaac
taccagcagcacttgttccaggagcgtcagatccggtcggtcacgtcgaacacccgcgcc
gatgcgcgcgcgttcttcgacttcgccgcccagcatcacatcgaggtcaccacgccggag
tacccgcttggccaagccgatcgtgcgctgggcgacctgagcgccggccgcatcgccggt
gccgccgtgctgctgatctga

DBGET integrated database retrieval system