KEGG   Mycobacterium tuberculosis H37Rv: Rv1885cHelp
Entry
Rv1885c           CDS       T00015                                 

Gene name
*MtCM
Definition
(RefSeq) chorismate mutase
  KO
K04093  chorismate mutase [EC:5.4.99.5]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv1885c (*MtCM)
Enzymes [BR:mtu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     Rv1885c (*MtCM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CM_2
Motif
Other DBs
NCBI-GeneID: 885772
NCBI-ProteinID: NP_216401
TubercuList: Rv1885c
UniProt: P9WIB9 I6XCR7
Structure
PDB: 

Position
complement(2134273..2134872)
Genome map
AA seq 199 aa AA seqDB search
MLTRPREIYLATAVSIGILLSLIAPLGPPLARADGTSQLAELVDAAAERLEVADPVAAFK
WRAQLPIEDSGRVEQQLAKLGEDARSQHIDPDYVTRVFDDQIRATEAIEYSRFSDWKLNP
ASAPPEPPDLSASRSAIDSLNNRMLSQIWSHWSLLSAPSCAAQLDRAKRDIVRSRHLDSL
YQRALTTATQSYCQALPPA
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcttacccgtccacgtgagatatacctcgcgaccgccgtctcgatcggcatcctgttg
tcgctgattgcaccactaggccccccgctggcgcgagccgacggcaccagccagttagcc
gagttggtcgacgccgccgctgagcggttggaggtcgccgacccggtggcagccttcaag
tggcgtgctcagctgcccattgaggattccggccgagtcgaacagcaactcgcaaagttg
ggcgaagatgcccgctcgcagcacatcgaccccgactacgtcacccgcgtcttcgacgac
cagattcgcgccaccgaggcaatcgagtacagccggttctcggactggaagctcaacccg
gccagcgcgcccccggagccgccggatctatcggcatcgcgatcggcgatcgactccctg
aataatcggatgctgtcgcagatttggagtcactggagtttgctgtccgcgccgtcctgc
gccgcccaactcgaccgcgccaaacgcgacatagtgcggtcccgccacctcgatagcctc
tatcaacgggccctgacgacagcaacacagtcgtattgccaggccctaccgccggcctga

DBGET integrated database retrieval system