KEGG   Mycobacterium tuberculosis H37Rv: Rv1908cHelp
Entry
Rv1908c           CDS       T00015                                 

Gene name
katG
Definition
(RefSeq) catalase-peroxidase
  KO
K03782  catalase-peroxidase [EC:1.11.1.21]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00360  Phenylalanine metabolism
mtu00380  Tryptophan metabolism
mtu00983  Drug metabolism - other enzymes
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    Rv1908c (katG)
   00380 Tryptophan metabolism
    Rv1908c (katG)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    Rv1908c (katG)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.21  catalase-peroxidase
     Rv1908c (katG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: peroxidase
Motif
Other DBs
NCBI-GeneID: 885638
NCBI-ProteinID: NP_216424
TubercuList: Rv1908c
UniProt: P9WIE5 I6YBX7 A0A0N9DQS3
Structure
PDB: 

Position
complement(2153889..2156111)
Genome map
AA seq 740 aa AA seqDB search
MPEQHPPITETTTGAASNGCPVVGHMKYPVEGGGNQDWWPNRLNLKVLHQNPAVADPMGA
AFDYAAEVATIDVDALTRDIEEVMTTSQPWWPADYGHYGPLFIRMAWHAAGTYRIHDGRG
GAGGGMQRFAPLNSWPDNASLDKARRLLWPVKKKYGKKLSWADLIVFAGNCALESMGFKT
FGFGFGRVDQWEPDEVYWGKEATWLGDERYSGKRDLENPLAAVQMGLIYVNPEGPNGNPD
PMAAAVDIRETFRRMAMNDVETAALIVGGHTFGKTHGAGPADLVGPEPEAAPLEQMGLGW
KSSYGTGTGKDAITSGIEVVWTNTPTKWDNSFLEILYGYEWELTKSPAGAWQYTAKDGAG
AGTIPDPFGGPGRSPTMLATDLSLRVDPIYERITRRWLEHPEELADEFAKAWYKLIHRDM
GPVARYLGPLVPKQTLLWQDPVPAVSHDLVGEAEIASLKSQIRASGLTVSQLVSTAWAAA
SSFRGSDKRGGANGGRIRLQPQVGWEVNDPDGDLRKVIRTLEEIQESFNSAAPGNIKVSF
ADLVVLGGCAAIEKAAKAAGHNITVPFTPGRTDASQEQTDVESFAVLEPKADGFRNYLGK
GNPLPAEYMLLDKANLLTLSAPEMTVLVGGLRVLGANYKRLPLGVFTEASESLTNDFFVN
LLDMGITWEPSPADDGTYQGKDGSGKVKWTGSRVDLVFGSNSELRALVEVYGADDAQPKF
VQDFVAAWDKVMNLDRFDVR
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgagcaacacccacccattacagaaaccaccaccggagccgctagcaacggctgt
cccgtcgtgggtcatatgaaataccccgtcgagggcggcggaaaccaggactggtggccc
aaccggctcaatctgaaggtactgcaccaaaacccggccgtcgctgacccgatgggtgcg
gcgttcgactatgccgcggaggtcgcgaccatcgacgttgacgccctgacgcgggacatc
gaggaagtgatgaccacctcgcagccgtggtggcccgccgactacggccactacgggccg
ctgtttatccggatggcgtggcacgctgccggcacctaccgcatccacgacggccgcggc
ggcgccgggggcggcatgcagcggttcgcgccgcttaacagctggcccgacaacgccagc
ttggacaaggcgcgccggctgctgtggccggtcaagaagaagtacggcaagaagctctca
tgggcggacctgattgttttcgccggcaactgcgcgctggaatcgatgggcttcaagacg
ttcgggttcggcttcggccgggtcgaccagtgggagcccgatgaggtctattggggcaag
gaagccacctggctcggcgatgagcgttacagcggtaagcgggatctggagaacccgctg
gccgcggtgcagatggggctgatctacgtgaacccggaggggccgaacggcaacccggac
cccatggccgcggcggtcgacattcgcgagacgtttcggcgcatggccatgaacgacgtc
gaaacagcggcgctgatcgtcggcggtcacactttcggtaagacccatggcgccggcccg
gccgatctggtcggccccgaacccgaggctgctccgctggagcagatgggcttgggctgg
aagagctcgtatggcaccggaaccggtaaggacgcgatcaccagcggcatcgaggtcgta
tggacgaacaccccgacgaaatgggacaacagtttcctcgagatcctgtacggctacgag
tgggagctgacgaagagccctgctggcgcttggcaatacaccgccaaggacggcgccggt
gccggcaccatcccggacccgttcggcgggccagggcgctccccgacgatgctggccact
gacctctcgctgcgggtggatccgatctatgagcggatcacgcgtcgctggctggaacac
cccgaggaattggccgacgagttcgccaaggcctggtacaagctgatccaccgagacatg
ggtcccgttgcgagataccttgggccgctggtccccaagcagaccctgctgtggcaggat
ccggtccctgcggtcagccacgacctcgtcggcgaagccgagattgccagccttaagagc
cagatccgggcatcgggattgactgtctcacagctagtttcgaccgcatgggcggcggcg
tcgtcgttccgtggtagcgacaagcgcggcggcgccaacggtggtcgcatccgcctgcag
ccacaagtcgggtgggaggtcaacgaccccgacggggatctgcgcaaggtcattcgcacc
ctggaagagatccaggagtcattcaactccgcggcgccggggaacatcaaagtgtccttc
gccgacctcgtcgtgctcggtggctgtgccgccatagagaaagcagcaaaggcggctggc
cacaacatcacggtgcccttcaccccgggccgcacggatgcgtcgcaggaacaaaccgac
gtggaatcctttgccgtgctggagcccaaggcagatggcttccgaaactacctcggaaag
ggcaacccgttgccggccgagtacatgctgctcgacaaggcgaacctgcttacgctcagt
gcccctgagatgacggtgctggtaggtggcctgcgcgtcctcggcgcaaactacaagcgc
ttaccgctgggcgtgttcaccgaggcctccgagtcactgaccaacgacttcttcgtgaac
ctgctcgacatgggtatcacctgggagccctcgccagcagatgacgggacctaccagggc
aaggatggcagtggcaaggtgaagtggaccggcagccgcgtggacctggtcttcgggtcc
aactcggagttgcgggcgcttgtcgaggtctatggcgccgatgacgcgcagccgaagttc
gtgcaggacttcgtcgctgcctgggacaaggtgatgaacctcgacaggttcgacgtgcgc
tga

DBGET integrated database retrieval system