KEGG   Mycobacterium tuberculosis H37Rv: Rv2029cHelp
Entry
Rv2029c           CDS       T00015                                 

Gene name
pfkB
Definition
(RefSeq) 6-phosphofructokinase PfkB
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00030  Pentose phosphate pathway
mtu00051  Fructose and mannose metabolism
mtu00052  Galactose metabolism
mtu00680  Methane metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv2029c (pfkB)
   00030 Pentose phosphate pathway
    Rv2029c (pfkB)
   00051 Fructose and mannose metabolism
    Rv2029c (pfkB)
   00052 Galactose metabolism
    Rv2029c (pfkB)
  09102 Energy metabolism
   00680 Methane metabolism
    Rv2029c (pfkB)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Rv2029c (pfkB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-GeneID: 887491
NCBI-ProteinID: NP_216545
TubercuList: Rv2029c
UniProt: P9WID3 I6YC89
Position
complement(2275405..2276424)
Genome map
AA seq 339 aa AA seqDB search
MTEPAAWDEGKPRIITLTMNPALDITTSVDVVRPTEKMRCGAPRYDPGGGGINVARIVHV
LGGCSTALFPAGGSTGSLLMALLGDAGVPFRVIPIAASTRESFTVNESRTAKQYRFVLPG
PSLTVAEQEQCLDELRGAAASAAFVVASGSLPPGVAADYYQRVADICRRSSTPLILDTSG
GGLQHISSGVFLLKASVRELRECVGSELLTEPEQLAAAHELIDRGRAEVVVVSLGSQGAL
LATRHASHRFSSIPMTAVSGVGAGDAMVAAITVGLSRGWSLIKSVRLGNAAGAAMLLTPG
TAACNRDDVERFFELAAEPTEVGQDQYVWHPIVNPEASP
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgacggagccagcggcgtgggacgaaggcaagccgcgaatcatcactttgaccatgaac
cccgccttggacatcacgacgagcgtcgacgtggtgcgcccgaccgagaaaatgcgttgt
ggcgcacctcgctacgatcccggcggcggcggtatcaatgtcgcccgcattgtgcatgtc
ctcggcggttgctcgacagcactgttcccggccggcgggtcgaccgggagcctgctgatg
gcgctgctcggtgatgcgggagtgccatttcgcgtcattccgatcgcggcctcgacgcgg
gagagcttcacggtcaacgagtccaggaccgccaagcagtatcgtttcgtgcttccgggg
ccgtcgctgaccgtcgcggagcaggagcaatgcctcgacgaactgcgcggtgcggcggct
tcggccgcctttgtggtggccagtggcagcctgccgccaggtgtggctgccgactactat
cagcgggttgccgacatctgccgccgatcgagcactccgctgatcctggatacatctggt
ggcgggttgcagcacatttcgtccggggtgtttcttctcaaggcgagcgtgcgggaactg
cgcgagtgcgtcggatccgaactgctgaccgagcccgaacaactggccgccgcacacgaa
ctcattgaccgtgggcgcgccgaggtcgtggtggtctcgcttggatctcagggcgcgcta
ttggccacacgacatgcgagccatcgattttcgtcgattccgatgaccgcggttagcggt
gtcggcgccggcgacgcgatggtggccgcgattaccgtgggcctcagccgtggctggtcg
ctcatcaagtccgttcgcttgggaaacgcggcaggtgcagccatgctgctgacgccaggc
accgcggcctgcaatcgcgacgatgtggagaggttcttcgagctggcggccgaacccacc
gaagtcgggcaggatcaatacgtttggcacccgatcgttaacccggaagcctcgccatga

DBGET integrated database retrieval system