KEGG   Mycobacterium tuberculosis H37Rv: Rv2051cHelp
Entry
Rv2051c           CDS       T00015                                 

Gene name
ppm1
Definition
(RefSeq) polyprenol-monophosphomannose synthase
  KO
K03820  apolipoprotein N-acyltransferase [EC:2.3.1.269]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Rv2051c (ppm1)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.269  apolipoprotein N-acyltransferase
     Rv2051c (ppm1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 CN_hydrolase Glyco_tranf_2_3
Motif
Other DBs
NCBI-GeneID: 887402
NCBI-ProteinID: NP_216567
TubercuList: Rv2051c
UniProt: O53493
Position
complement(2308131..2310755)
Genome map
AA seq 874 aa AA seqDB search
MKLGAWVAAQLPTTRTAVRTRLTRLVVSIVAGLLLYASFPPRNCWWAAVVALALLAWVLT
HRATTPVGGLGYGLLFGLVFYVSLLPWIGELVGPGPWLALATTCALFPGIFGLFAVVVRL
LPGWPIWFAVGWAAQEWLKSILPFGGFPWGSVAFGQAEGPLLPLVQLGGVALLSTGVALV
GCGLTAIALEIEKWWRTGGQGDAPPAVVLPAACICLVLFAAIVVWPQVRHAGSGSGGEPT
VTVAVVQGNVPRLGLDFNAQRRAVLDNHVEETLRLAADVHAGLAQQPQFVIWPENSSDID
PFVNPDAGQRISAAAEAIGAPILIGTLMDVPGRPRENPEWTNTAIVWNPGTGPADRHDKA
IVQPFGEYLPMPWLFRHLSGYADRAGHFVPGNGTGVVRIAGVPVGVATCWEVIFDRAPRK
SILGGAQLLTVPSNNATFNKTMSEQQLAFAKVRAVEHDRYVVVAGTTGISAVIAPDGGEL
IRTDFFQPAYLDSQVRLKTRLTPATRWGPILQWILVGAAAAVVLVAMRQNGWFPRPRRSE
PKGENDDSDAPPGRSEASGPPALSESDDELIQPEQGGRHSSGFGRHRATSRSYMTTGQPA
PPAPGNRPSQRVLVIIPTFNERENLPVIHRRLTQACPAVHVLVVDDSSPDGTGQLADELA
QADPGRTHVMHRTAKNGLGAAYLAGFAWGLSREYSVLVEMDADGSHAPEQLQRLLDAVDA
GADLAIGSRYVAGGTVRNWPWRRLVLSKTANTYSRLALGIGIHDITAGYRAYRREALEAI
DLDGVDSKGYCFQIDLTWRTVSNGFVVTEVPITFTERELGVSKMSGSNIREALVKVARWG
IEGRLSRSDHARARPDIARPGAGGSRVSRADVTE
NT seq 2625 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcttggcgcctgggtggcagcgcagctgcccaccacacggaccgcggtgcggacg
cggctgacgcgcctggtggtcagcatcgtggccggtctgctgttgtatgccagcttcccg
ccgcgcaactgctggtgggcggcggtggttgcgctcgcattgctggcctgggtgctgacc
caccgcgcgacgacaccggtgggtgggctgggctacggcctgctattcggcctggtgttc
tacgtctcgttgttgccgtggatcggcgagctggtgggccccgggccctggttggcactg
gcgacgacgtgcgcgctgttccccggcatcttcggtctgttcgccgtcgtggtacgcctg
ttgccgggttggccgatctggttcgcggtggggtgggcggcgcaggagtggttgaagtcg
atccttccgttcggtggatttccgtgggggtcggtcgccttcggtcaagccgaaggcccg
ctgttgccgttggtccagctcggcggtgtggcgctgctgtcaacgggggtagcgctggtc
ggatgcggcttgaccgcgatcgcgctggaaatcgagaagtggtggcgaaccggtggtcag
ggggatgcgccgccggcggtggtgctgccggccgcgtgcatatgcctggtcttgttcgcc
gccatcgtcgtctggccgcaggtgcggcatgcgggtagcggatcgggcggcgaacccacg
gtcaccgtcgcggtggtccagggcaatgtgccccggctcggtctcgacttcaatgcgcaa
cgtcgggcggtgctagacaaccacgttgaggagacgttgcggctggccgccgacgtgcat
gcggggctggcgcagcaaccccagttcgtcatctggccggagaactcgtcggacatcgac
ccgttcgtcaaccccgacgccggtcaacggatctccgcagcggccgaagcgatcggcgcg
ccgatcctgatcggcaccctgatggatgttccgggccgtcctcgtgaaaatccggagtgg
accaatacggccattgtctggaatcccggcaccgggccggccgaccgccacgacaaggca
atcgtgcagcccttcggcgagtacctgcccatgccgtggctgtttcggcacctctccggc
tacgccgaccgcgccggccacttcgtgcccggcaacggcaccggtgtggtgcgcatcgct
ggggtcccggtcggggtggctacctgctgggaggtgatcttcgaccgcgccccgcggaag
tcgattctgggcggcgcgcagctgttgaccgtgcccagcaacaacgccaccttcaacaag
acaatgagcgaacagcagctggcattcgccaaggtacgggccgtcgagcacgacagatac
gtggtggttgccggtaccactgggatcagtgcggtgatagcaccagacgggggtgagctg
atccggaccgactttttccagcccgcatacctggacagccaggtgcgcctcaagacgagg
ctgacaccggcaactcgatggggtccaatcctgcaatggattctcgtcggggcagccgca
gcggtcgttctcgtcgccatgcggcagaatgggtggttcccgcgtccgaggcgctcggag
ccaaagggcgaaaatgacgattccgatgcgcccccgggcagatctgaggcctccggtccg
ccggccctgagtgaatccgacgacgaactcattcagcccgagcagggcggccgacactca
tccggtttcggacgacacagagcaacatcgaggagttacatgaccaccggccagccggcg
cccccagccccgggtaaccgtcccagccagcgcgtcctggtgatcattcctacgttcaac
gagcgggagaaccttccggtgatccaccggcggctgacgcaagcatgccccgccgtgcac
gtgctggtcgtcgacgacagcagccccgacggcaccggccagctcgccgacgagctggcg
caggccgatcccggccgcacccacgtgatgcaccgcaccgccaagaacggtttgggcgcg
gcgtacctggcaggtttcgcctgggggttgagccgggagtattcggtgctggtcgagatg
gatgccgacggcagccacgcgcccgaacagctgcagcgcctgctggacgccgtcgacgct
ggtgccgatcttgcgattggttcgcgctatgtcgcgggggggacggtacgaaactggcct
tggcggcggctagtcctgtccaaaaccgctaacacctattcgcgcctggcgctcggaatc
gggatccacgacatcaccgctggctaccgcgcgtaccgccgcgaagcactcgaagcgatt
gacctggacggcgtggactccaagggctactgcttccagatcgatctcacctggcgcacg
gtgagcaacgggttcgtcgtcaccgaggtgccgattacctttaccgagcgcgagctcggt
gtgtccaagatgagcgggtccaacattcgtgaggcgctggtcaaagtcgcccgctggggc
atcgagggacgcctttcgcgctcggaccacgcacgcgcacgaccggacattgcccggccg
ggagcagggggttcccgggtcagccgcgccgacgtgaccgaatga

DBGET integrated database retrieval system