KEGG   Mycobacterium tuberculosis H37Rv: Rv2072cHelp
Entry
Rv2072c           CDS       T00015                                 

Gene name
cobL
Definition
(RefSeq) precorrin-6Y C(5,15)-methyltransferase
  KO
K00595  precorrin-6Y C5,15-methyltransferase (decarboxylating) [EC:2.1.1.132]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00860  Porphyrin and chlorophyll metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Rv2072c (cobL)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.132  precorrin-6B C5,15-methyltransferase (decarboxylating)
     Rv2072c (cobL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase Methyltransf_2 MTS
Motif
Other DBs
NCBI-GeneID: 888321
NCBI-ProteinID: NP_216588
TubercuList: Rv2072c
UniProt: P9WGA9 I6XD90
Position
complement(2328974..2330146)
Genome map
AA seq 390 aa AA seqDB search
MIIVVGIGADGMTGLSEHSRSELRRATVIYGSKRQLALLDDTVTAERWEWPTPMLPAVQG
LSPDGADLHVVASGDPLLHGIGSTLIRLFGHDNVTVLPHVSAVTLACARMGWNVYDTEVI
SLVTAQPHTAVRRGGRAIVLSGDRSTPQALAVLLTEHGRGDSKFSVLEQLGGPAERRRDG
TARAWACDPPLDVDELNVIAVRYLLDERTSWAPDEAFAHDGQITKHPIRVLTLAALAPRP
GQRLWDVGAGSGAIAVQWCRSWPGCTAVAFERDERRRRNIGFNAAAFGVSVDVRGDAPDA
FDDAARPSVIFLGGGVTQPGLLEACLDSLPAGGNLVANAVTVESEAALAHAYSRLGGELR
RFQHYLGEPLGGFTGWRPQLPVTQWSVTKR
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcgttgtcgggatcggcgccgacggcatgaccggtctctccgagcattctcgc
tccgaattgcgcagggccacagtaatttacggctcgaaacggcaacttgccctgctcgac
gataccgtcaccgccgagcgctgggagtggccgacgccgatgctgcccgcggtgcaaggc
ctgtcaccggatggggctgacctacacgtggttgccagcggcgacccgttgttgcatggt
atcggctccaccctgatccggctgttcggccacgacaacgtgaccgtgttgccgcacgtg
tccgcggtgacgttggcgtgcgcccggatgggctggaacgtgtatgacaccgaggtgatc
agcctggtcaccgcgcaaccacacaccgcggtgcgccgcggcggccgggccatcgtgctg
tccggcgatcggtccaccccgcaggcgctggcggtgctgctgaccgagcacggtcgcggt
gactccaagttcagcgtgctcgaacagcttggcggcccggccgaacgccgccgcgacggt
acggcccgggcatgggcctgcgacccacccctcgatgtcgatgagctcaacgtgatcgcc
gtgcgctacctgctcgacgagcgcacgtcgtgggcacccgacgaggcattcgcgcacgac
gggcagatcaccaaacacccgatccgcgtgctgaccctggctgcgctggcgccaaggccc
gggcagcggttatgggacgtcggcgcgggctcaggcgccatcgcggtccagtggtgtcgg
agctggccgggctgcaccgcggtggcgttcgagcgcgacgaacggcgccgccgcaacatt
gggttcaatgccgcggccttcggggtgagcgtcgacgtgcgcggcgacgcgcccgatgcg
ttcgacgacgccgcacggccgtcggtgatttttcttggcggtggtgtaacccagccaggc
ctgcttgaggcctgcctggacagcctgcccgcaggcgggaacttggtcgccaacgctgtc
accgtcgaatcggaagccgctctggcgcatgcatattcgcgcctcggtggcgagctacga
cgattccagcactatctcggcgaaccgctgggcggcttcaccggttggcgcccacagctg
ccggtcacccagtggtcggtgaccaagcgatga

DBGET integrated database retrieval system