KEGG   Mycobacterium tuberculosis H37Rv: Rv2121cHelp
Entry
Rv2121c           CDS       T00015                                 

Gene name
hisG
Definition
(RefSeq) ATP phosphoribosyltransferase
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00340  Histidine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01230  Biosynthesis of amino acids
Module
mtu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Rv2121c (hisG)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     Rv2121c (hisG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HisG HisG_C DUF1990
Motif
Other DBs
NCBI-GeneID: 888689
NCBI-ProteinID: NP_216637
TubercuList: Rv2121c
UniProt: P9WMN1 I6X398
Structure
PDB: 

Position
complement(2379806..2380660)
Genome map
AA seq 284 aa AA seqDB search
MLRVAVPNKGALSEPATEILAEAGYRRRTDSKDLTVIDPVNNVEFFFLRPKDIAIYVGSG
ELDFGITGRDLVCDSGAQVRERLALGFGSSSFRYAAPAGRNWTTADLAGMRIATAYPNLV
RKDLATKGIEATVIRLDGAVEISVQLGVADAIADVVGSGRTLSQHDLVAFGEPLCDSEAV
LIERAGTDGQDQTEARDQLVARVQGVVFGQQYLMLDYDCPRSALKKATAITPGLESPTIA
PLADPDWVAIRALVPRRDVNGIMDELAAIGAKAILASDIRFCRF
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgggtcgcggttcccaacaagggtgcgctgagcgagccggccaccgagatcctc
gcggaggccggctaccgccgccgcaccgattccaaagacttgaccgtcatcgatccggtc
aacaacgtcgagttcttcttcttgcggcccaaagacattgccatatatgtcggttcggga
gagctcgacttcgggatcaccggacgcgacctggtgtgcgattccggtgcacaggttcgg
gaacgcctggcgctgggcttcgggtcgtccagcttccgctatgccgctcccgccgggcgg
aactggacgactgccgacctagccgggatgcggatcgccaccgcctacccgaatctggtc
cggaaagatctggccaccaagggaatcgaagcaacggtcatcagacttgatggtgccgtg
gagatctcggtgcagctcggggtggccgatgccatcgccgatgtggtggggtcgggtcgc
acgctgagccagcacgacctggtggcctttggtgagccgctgtgcgattcggaggcggtg
ctcatcgagcgggccggtacggacggccaagaccagaccgaggcgcgcgatcaactggtc
gctcgggtgcagggggtggtcttcggccagcagtatctgatgctcgactacgattgcccg
cgctcggcgttgaagaaggccacggcgatcacgccggggctggagtcaccgaccatcgcc
ccgctggccgacccggactgggtggcaatccgcgccctggtgccgcgccgggacgtcaac
ggcatcatggatgagctcgctgcgatcggggccaaagcgattctggcgtcggacatcagg
ttctgccgattctga

DBGET integrated database retrieval system