KEGG   Mycobacterium tuberculosis H37Rv: Rv2122cHelp
Entry
Rv2122c           CDS       T00015                                 

Gene name
hisE
Definition
(RefSeq) phosphoribosyl-ATP pyrophosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00340  Histidine metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01230  Biosynthesis of amino acids
Module
mtu_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    Rv2122c (hisE)
Enzymes [BR:mtu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Rv2122c (hisE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH MazG
Motif
Other DBs
NCBI-GeneID: 888671
NCBI-ProteinID: YP_177860
TubercuList: Rv2122c
UniProt: P9WMM9 I6Y8F9
Structure
PDB: 

Position
complement(2380663..2380944)
Genome map
AA seq 93 aa AA seqDB search
MQQSLAVKTFEDLFAELGDRARTRPADSTTVAALDGGVHALGKKLLEEAGEVWLAAEHES
NDALAEEISQLLYWTQVLMISRGLSLDDVYRKL
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
gtgcaacaatcgctggccgtgaagaccttcgaggatctgttcgccgaactcggcgatcgt
gcccgcacccggccggccgacagcaccacggtggcggcattggacggcggggttcatgct
ctgggtaagaagcttctcgaggaggccggcgaggtgtggctggctgccgagcacgaatcc
aacgacgcactggcggaggagatcagccagttgctgtactggacgcaggtgctgatgatc
tcccgtggactgtccctcgacgacgtctatcgaaagctgtga

DBGET integrated database retrieval system