KEGG   Mycobacterium tuberculosis H37Rv: Rv2153cHelp
Entry
Rv2153c           CDS       T00015                                 

Gene name
murG
Definition
(RefSeq) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol-N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00550  Peptidoglycan biosynthesis
mtu01100  Metabolic pathways
mtu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rv2153c (murG)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Rv2153c (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
    Rv2153c (murG)
Enzymes [BR:mtu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     Rv2153c (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
 Precursor biosynthesis
  Glycosyltransferase
   Rv2153c (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tran_28_C Glyco_transf_28 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 888036
NCBI-ProteinID: NP_216669
TubercuList: Rv2153c
UniProt: P9WJK9 I6X3D5
Position
complement(2412119..2413351)
Genome map
AA seq 410 aa AA seqDB search
MKDTVSQPAGGRGATAPRPADAASPSCGSSPSADSVSVVLAGGGTAGHVEPAMAVADALV
ALDPRVRITALGTLRGLETRLVPQRGYHLELITAVPMPRKPGGDLARLPSRVWRAVREAR
DVLDDVDADVVVGFGGYVALPAYLAARGLPLPPRRRRRIPVVIHEANARAGLANRVGAHT
ADRVLSAVPDSGLRRAEVVGVPVRASIAALDRAVLRAEARAHFGFPDDARVLLVFGGSQG
AVSLNRAVSGAAADLAAAGVCVLHAHGPQNVLELRRRAQGDPPYVAVPYLDRMELAYAAA
DLVICRAGAMTVAEVSAVGLPAIYVPLPIGNGEQRLNALPVVNAGGGMVVADAALTPELV
ARQVAGLLTDPARLAAMTAAAARVGHRDAAGQVARAALAVATGAGARTTT
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggacacggtcagccagccggccggcgggcgcggggcaacggcgccccggcccgcc
gatgccgcctcgccgtcttgtggttcctcgccgtctgctgattccgtgtcggtcgttctc
gccggcggcgggaccgccgggcacgtcgagcccgccatggccgtcgccgacgccttggtc
gcgttggatccgcgcgtccggattaccgcgttgggcaccctccgtggactagagaccagg
ctggtgccccagcgcggctaccacctggagctgatcacggcggtgccgatgccgcgcaag
cccggcggcgacctggcccggctgccgtcgcgggtgtggcgcgccgtccgggaggcccgg
gacgtgctcgacgatgtcgacgccgacgtcgtcgtcggtttcggtgggtacgtcgcgcta
ccggcttacctagccgctcgcggcctgcctttgccgccccggcgccggcgccggatcccg
gtggtgatccacgaagccaacgccagggcgggactggccaaccgggtcggcgcccatacc
gcggaccgggtgctctccgcggtgccggattccgggctgcggcgcgccgaggtggttggg
gtcccggtccgtgcgtcgatcgccgcgctggaccgcgcggtgctgcgagccgaggcgcgg
gcacacttcggcttccccgacgacgcgcgggtgctgctggtgttcgggggttcgcagggc
gcggtctcgctcaaccgggcggtgtccggcgccgccgccgacctggccgccgccggtgtt
tgcgtgctgcatgcccatggaccccagaacgtgctggagttgcgccgtcgggctcaaggt
gacccaccgtacgtggcggtgccctatttggaccggatggagctggcctacgccgccgcc
gatctggtgatctgccgggccggggcgatgacggtcgccgaagtatccgccgtcggtctg
ccggccatctacgtgccgctgccgatcggcaacggtgaacagcggctgaatgcgttgccg
gtagtcaatgccggcggcggcatggtggtcgccgacgccgccctgacccccgagttggtg
gcccgccaggttgccgggctgctcaccgaccccgcgcggctggccgcgatgaccgcggcc
gcagccagggtgggacatcgcgatgccgcgggccaggtggcccgggccgcgctggccgtc
gccaccggggccggtgccaggacaacgacgtga

DBGET integrated database retrieval system