KEGG   Mycobacterium tuberculosis H37Rv: Rv2156cHelp
Entry
Rv2156c           CDS       T00015                                 

Gene name
murX
Definition
(RefSeq) phospho-N-acetylmuramoyl-pentappeptidetransferase
  KO
K01000  phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00550  Peptidoglycan biosynthesis
mtu01100  Metabolic pathways
mtu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rv2156c (murX)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Rv2156c (murX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
    Rv2156c (murX)
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     Rv2156c (murX)
Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
 Precursor biosynthesis
  Glycosyltransferase
   Rv2156c (murX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_4 MraY_sig1
Motif
Other DBs
NCBI-GeneID: 888098
NCBI-ProteinID: NP_216672
TubercuList: Rv2156c
UniProt: P9WMW7 I6XDH8
Position
complement(2416396..2417475)
Genome map
AA seq 359 aa AA seqDB search
MRQILIAVAVAVTVSILLTPVLIRLFTKQGFGHQIREDGPPSHHTKRGTPSMGGVAILAG
IWAGYLGAHLAGLAFDGEGIGASGLLVLGLATALGGVGFIDDLIKIRRSRNLGLNKTAKT
VGQITSAVLFGVLVLQFRNAAGLTPGSADLSYVREIATVTLAPVLFVLFCVVIVSAWSNA
VNFTDGLDGLAAGTMAMVTAAYVLITFWQYRNACVTAPGLGCYNVRDPLDLALIAAATAG
ACIGFLWWNAAPAKIFMGDTGSLALGGVIAGLSVTSRTEILAVVLGALFVAEITSVVLQI
LTFRTTGRRMFRMAPFHHHFELVGWAETTVIIRFWLLTAITCGLGVALFYGEWLAAVGA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagatccttatcgccgttgccgtagcggtgacggtgtccatcttgctgaccccg
gtgctgatccggttgttcactaagcagggcttcggccaccagatccgtgaggatggcccg
cccagccaccacaccaagcgcggtacgccgtcgatgggcggggtggcgattctggccggc
atctgggcgggctacctgggcgcccacctagcgggcctggcgtttgacggtgaaggcatc
ggcgcatcgggtctgttggtgctgggcctagccaccgctttgggcggcgtcgggttcatc
gacgatctgatcaagatccgcaggtcgcgcaatctcgggttgaacaagacggccaagacc
gtcgggcagatcacctccgccgtgctgtttggcgtgctggtgctgcagttccggaatgct
gccggcctgacaccgggcagcgcggatctgtcctacgtgcgtgagatcgccaccgtcaca
ttggcgccggtgctgttcgtgttgttctgcgtggtcatcgtcagcgcctggtcgaacgcg
gtcaacttcaccgatggcctggacgggctggccgccggcaccatggcgatggtcaccgcc
gcctacgtgctgatcaccttctggcagtaccgcaacgcgtgcgtgacggcgccgggcctg
ggctgctacaacgtgcgcgacccgctggacctggcgctcatcgcggccgcaaccgctggc
gcctgcatcggttttttgtggtggaacgccgcgcccgccaagatcttcatgggtgacact
gggtcgctggcgttgggcggcgtcatcgcggggttgtcggtgaccagccgcaccgagatc
cttgcggtggtgctgggtgcgctgttcgtcgccgagatcacctcggtggtgttgcaaatc
ctgaccttccggaccaccgggcgccggatgtttcggatggcgcccttccaccaccatttc
gagttggtcggttgggctgaaaccacggtcatcatccggttctggctgctcaccgcgatc
acctgcggtctgggcgtggccttgttctacggtgagtggcttgccgcggtcggtgcctga

DBGET integrated database retrieval system