KEGG   Mycobacterium tuberculosis H37Rv: Rv2158cHelp
Entry
Rv2158c           CDS       T00015                                 

Gene name
murE
Definition
(RefSeq) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00300  Lysine biosynthesis
mtu00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Rv2158c (murE)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rv2158c (murE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
    Rv2158c (murE)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Rv2158c (murE)
Peptidoglycan biosynthesis and degradation proteins [BR:mtu01011]
 Precursor biosynthesis
  Amino acid ligase
   Rv2158c (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Mur_ligase DUF1611 FUSC-like
Motif
Other DBs
NCBI-GeneID: 887252
NCBI-ProteinID: NP_216674
TubercuList: Rv2158c
UniProt: P9WJL3
Structure
PDB: 

Position
complement(2419001..2420608)
Genome map
AA seq 535 aa AA seqDB search
MSSLARGISRRRTEVATQVEAAPTGLRPNAVVGVRLAALADQVGAALAEGPAQRAVTEDR
TVTGVTLRAQDVSPGDLFAALTGSTTHGARHVGDAIARGAVAVLTDPAGVAEIAGRAAVP
VLVHPAPRGVLGGLAATVYGHPSERLTVIGITGTSGKTTTTYLVEAGLRAAGRVAGLIGT
IGIRVGGADLPSALTTPEAPTLQAMLAAMVERGVDTVVMEVSSHALALGRVDGTRFAVGA
FTNLSRDHLDFHPSMADYFEAKASLFDPDSALRARTAVVCIDDDAGRAMAARAADAITVS
AADRPAHWRATDVAPTDAGGQQFTAIDPAGVGHHIGIRLPGRYNVANCLVALAILDTVGV
SPEQAVPGLREIRVPGRLEQIDRGQGFLALVDYAHKPEALRSVLTTLAHPDRRLAVVFGA
GGDRDPGKRAPMGRIAAQLADLVVVTDDNPRDEDPTAIRREILAGAAEVGGDAQVVEIAD
RRDAIRHAVAWARPGDVVLIAGKGHETGQRGGGRVRPFDDRVELAAALEALERRA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
gtgtcatcgctggcccgagggatctcgcggcggcgaacggaggtggcgacacaggtggag
gctgcgcccactggcttgcgccccaacgccgtcgtgggcgttcggttggccgcactggcc
gatcaggtcggcgcggccctggccgagggtccagctcagcgtgccgtcaccgaggaccgg
acggtcaccggggtcacgctgcgcgcccaggacgtgtcacccggtgacctgttcgccgcc
ctgaccggctcgaccacccacggggcccgccacgtcggcgacgcgatcgcacgcggcgcc
gtcgcggtgctcaccgaccccgccggggtcgccgagatcgccggacgagcggccgtgccc
gtgttggtgcaccccgcaccccgcggcgtgctcggcggcttggccgccaccgtgtacggg
catccgtccgagcggttgacggttatcgggatcaccggaacgtccggcaagaccaccacc
acctatctggtcgaggccgggttacgggctgccggacgcgtcgccgggctgatcggcacc
atcggcatccgcgtcggcggcgccgaccttcccagcgcgctgaccaccccggaggccccc
acgctgcaggcgatgctggcggcgatggtcgaacgcggggtggacaccgtggtcatggag
gtgtccagccacgcgctggcgctgggccgggtggacggcacccggttcgccgtcggcgcc
ttcaccaatctctcccgtgaccacctggatttccaccccagcatggccgactacttcgag
gccaaggcgtcattgttcgatccggactcggcactgcgcgcccgcaccgccgtggtgtgc
atcgacgacgacgccgggcgcgcgatggcggcgcgggccgccgacgcgatcaccgtcagc
gccgccgaccggcccgcacactggcgcgccacggatgtggcgcccacggacgcgggcggg
caacaattcaccgccatcgaccccgccggcgtagggcatcacatcggaatccggctaccg
ggccgctacaacgtcgccaattgcctggtcgccctggcgattctggacaccgtcggggtc
tccccggaacaggcggtgccgggcctgcgtgagatccgggtcccggggcggctcgagcag
atcgaccgcggccagggctttctcgcgctggtcgactacgcgcacaaaccggaagcgctg
cggtcggtgctgaccaccttggcgcacccggaccgccggctggcggtggtgttcggcgcc
ggcggcgatcgtgacccgggcaagcgggccccgatgggccggatagccgcgcagctggcc
gacttggtggtcgtcaccgacgacaacccgcgtgacgaagatcccacggcgatccgccgc
gaaatcctggctggggcggccgaagtcggcggtgatgcccaggtcgtcgagatcgcagac
cggcgggacgcgatccggcacgcggttgcctgggcgcgccccggcgacgtggtgctcatc
gccggcaaaggccacgagaccgggcaacgcggcggcgggcgggtccgcccgttcgacgac
cgggtggagctggctgccgcgctagaggccctcgagcggcgcgcatga

DBGET integrated database retrieval system