KEGG   Mycobacterium tuberculosis H37Rv: Rv2178cHelp
Entry
Rv2178c           CDS       T00015                                 

Gene name
aroG
Definition
(RefSeq) phospho-2-dehydro-3-deoxyheptonate aldolase AroG
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01230  Biosynthesis of amino acids
mtu02024  Quorum sensing
Module
mtu_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Rv2178c (aroG)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Rv2178c (aroG)
Enzymes [BR:mtu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     Rv2178c (aroG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-GeneID: 888309
NCBI-ProteinID: NP_216694
TubercuList: Rv2178c
UniProt: O53512 I6X3I6
Structure
PDB: 

Position
complement(2440332..2441720)
Genome map
AA seq 462 aa AA seqDB search
MNWTVDIPIDQLPSLPPLPTDLRTRLDAALAKPAAQQPTWPADQALAMRTVLESVPPVTV
PSEIVRLQEQLAQVAKGEAFLLQGGDCAETFMDNTEPHIRGNVRALLQMAVVLTYGASMP
VVKVARIAGQYAKPRSADIDALGLRSYRGDMINGFAPDAAAREHDPSRLVRAYANASAAM
NLVRALTSSGLASLHLVHDWNREFVRTSPAGARYEALATEIDRGLRFMSACGVADRNLQT
AEIYASHEALVLDYERAMLRLSDGDDGEPQLFDLSAHTVWIGERTRQIDGAHIAFAQVIA
NPVGVKLGPNMTPELAVEYVERLDPHNKPGRLTLVSRMGNHKVRDLLPPIVEKVQATGHQ
VIWQCDPMHGNTHESSTGFKTRHFDRIVDEVQGFFEVHRALGTHPGGIHVEITGENVTEC
LGGAQDISETDLAGRYETACDPRLNTQQSLELAFLVAEMLRD
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgaactggaccgtcgacataccgatcgaccagctcccgtcgcttccgccgctgccgact
gacctgcgaacacgactggacgccgcgctggccaagccggcggcccagcaacccacctgg
ccggccgaccaggcgttggcgatgcgcacggtgttggagagcgtgccacccgtgacggtg
ccgtccgagatcgtccggctgcaagagcagctggcccaggtggcaaagggtgaggctttc
ctgctgcagggcggcgactgcgctgagacattcatggacaacaccgaaccccatattcgg
ggcaatgtccgtgccttgttgcagatggccgtggtgctgacctacggcgccagcatgcca
gtggtgaaggtggcccgcatcgccggtcagtacgcgaagcctcggtcagccgacattgac
gcgctgggtctgcggtcttaccgcggcgacatgatcaacggcttcgccccggacgccgcg
gcgcgcgagcacgacccgtcgcggctggtccgggcttacgctaacgccagtgcggcgatg
aacttggtgcgtgcgctgacttcgtcgggcctggcgtcgctgcatctggttcacgactgg
aaccgggaattcgtccggacctcgccggccggcgcgcgctatgaggcgctggccaccgag
atcgatcgtgggctgcggttcatgagtgcctgtggggtggccgaccgcaatctacagacc
gccgaaatctatgccagccatgaagctttggtgctcgactacgagcgcgccatgttgagg
ttgtccgacggtgacgacggtgaaccacaactgtttgacctgtccgcacacaccgtgtgg
atcggcgagcggacccgacaaatcgatggcgcgcacatcgcgtttgcccaggtgattgct
aatccggtcggggtcaagttgggccccaacatgaccccggaactggccgtggagtacgtc
gagcggctcgacccgcacaataagccgggccggctgacgttggtgagcaggatgggcaac
cacaaggtccgcgatctgttgccaccgatcgtggagaaggtccaggccaccgggcatcag
gtgatctggcaatgcgacccgatgcacggcaacacccacgagtcgtccacggggttcaag
acccgtcacttcgatcgcattgtcgatgaagtgcagggttttttcgaggtgcatcgtgcc
ctcggaacccatccgggcggcatccatgtcgagattaccggcgagaacgtcaccgaatgt
cttggtggcgcgcaagacatttcggagacggacttggccggccgctatgagacggcatgt
gatccgcggctgaacacccagcagtcgctggagttggcgttcctggtcgcggagatgctg
cgggactag

DBGET integrated database retrieval system