KEGG   Mycobacterium tuberculosis H37Rv: Rv2201Help
Entry
Rv2201            CDS       T00015                                 

Gene name
asnB
Definition
(RefSeq) asparagine synthetase
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00250  Alanine, aspartate and glutamate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Rv2201 (asnB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mtu01002]
    Rv2201 (asnB)
Enzymes [BR:mtu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Rv2201 (asnB)
Peptidases [BR:mtu01002]
 Cysteine Peptidases
  Family C44
   Rv2201 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 QueC NAD_synthase Shadoo
Motif
Other DBs
NCBI-GeneID: 888472
NCBI-ProteinID: NP_216717
TubercuList: Rv2201
UniProt: P9WN33 I6YCT5
Position
2464997..2466955
Genome map
AA seq 652 aa AA seqDB search
MCGLLAFVAAPAGAAGPEGADAASAIARASHLMRHRGPDESGTWHAVDGASGGVVFGFNR
LSIIDIAHSHQPLRWGPPEAPDRYVLVFNGEIYNYLELRDELRTQHGAVFATDGDGEAIL
AGYHHWGTEVLQRLRGMFAFALWDTVTRELFCARDPFGIKPLFIATGAGGTAVASEKKCL
LDLVELVGFDTEIDHRALQHYTVLQYVPEPETLHRGVRRLESGCFARIRADQLAPVITRY
FVPRFAASPITNDNDQARYDEITAVLEDSVAKHMRADVTVGAFLSGGIDSTAIAALAIRH
NPRLITFTTGFEREGFSEIDVAVASAEAIGARHIAKVVSADEFVAALPEIVWYLDEPVAD
PALVPLFFVAREARKHVKVVLSGEGADELFGGYTIYREPLSLRPFDYLPKPLRRSMGKVS
KPLPEGMRGKSLLHRGSLTLEERYYGNARSFSGAQLREVLPGFRPDWTHTDVTAPVYAES
AGWDPVARMQHIDLFTWLRGDILVKADKITMANSLELRVPFLDPEVFAVASRLPAGAKIT
RTTTKYALRRALEPIVPAHVLHRPKLGFPVPIRHWLRAGELLEWAYATVGSSQAGHLVDI
AAVYRMLDEHRCGSSDHSRRLWTMLIFMLWHAIFVEHSVVPQISEPQYPVQL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtggactgctggccttcgtcgcggccccggccggtgctgcggggcccgaaggtgcc
gacgctgccagcgccatcgcccgcgcatcgcatttgatgcgccaccgcgggcccgatgaa
tcgggcacctggcacgccgtcgatggcgcctccggaggcgtcgtgttcgggttcaaccga
ctgtccatcatcgacatcgcgcactcgcatcagccgctgcggtgggggccgccggaggct
ccggaccgctacgtgctggtgttcaacggcgagatctacaactacttggagctgcgtgac
gagctgcgcacccagcacggcgctgtgttcgccaccgacggcgacggtgaggcgatcctc
gccggctatcaccactggggcaccgaggtgctgcagcggttgcgcggcatgttcgcattc
gcgctgtgggacaccgtcacccgcgaattgttctgcgcgcgagatccgttcggcatcaag
ccgttgtttatcgccaccggagccggcggcacggcggtggccagtgagaagaaatgcctg
ctggacctcgtcgagttggtggggttcgacaccgagatcgaccatcgggcgttgcagcac
tacaccgtcctgcagtacgtgccggaacccgagacactgcaccgtggggtacgtcggctg
gaatcaggctgcttcgcccggatccgtgccgaccagctcgcgccggtgatcacccgttat
ttcgtgccgcgatttgcggccagtccgatcaccaacgacaacgaccaggcccgctatgac
gagatcacggcagtgcttgaggactcggtggccaagcatatgcgcgccgatgtcaccgtc
ggcgcgtttctgtccgggggtatcgactccacggccatcgcggcgctggccatccggcac
aatccgcggctgatcaccttcaccaccggtttcgagcgcgagggcttctccgagatcgac
gtcgcggtggcttcggcagaggccatcggtgcccgtcacatcgccaaggtggtcagcgcc
gacgagttcgtcgccgccctgcccgagatcgtctggtacctcgacgagccggtcgctgac
ccagcgctggtaccgttgttcttcgtcgcccgcgaggcccgaaagcacgtcaaagtggtg
ttgtcgggcgaaggcgccgacgaactgttcggcggctacacaatctatcgagaaccgctg
tcgttgaggccgtttgactacctgcccaagccactgcgccggtcgatgggaaaagtttcc
aagccactgccggagggcatgcgcggcaagagtctgctgcaccgcggatcgctgacactc
gaagagcgctactacggcaatgcccgcagtttctccggcgcgcagctgcgcgaagtactg
cccgggttccggccggactggacccacacagatgtcacggcgccggtctacgccgaatcg
gccggctgggatccggtggcgcgaatgcagcacatcgacctgttcacctggctgcgcggc
gacattctggtcaaggccgacaagataacgatggccaactccctggagctgcgggtgccg
ttcctggacccggaggttttcgcggtggcctcccggttgccggcgggcgccaagatcacc
cgtaccaccaccaagtacgcgctgcggcgcgcgctggagcctattgtgcccgcacacgtg
ctgcaccggcccaagctcgggttcccggtcccgatccggcattggctgcgtgccggcgag
ctgctggagtgggcgtatgcgacggtgggctcgtcgcaggccggtcacttggttgacatc
gccgccgtgtatcgcatgctcgacgagcaccggtgcggcagcagcgaccacagccgccgg
ctgtggaccatgctgatctttatgctgtggcacgcgatcttcgtcgagcacagcgtggtg
ccccagatcagcgagccgcagtaccccgtccagttgtaa

DBGET integrated database retrieval system