KEGG   Mycobacterium tuberculosis H37Rv: Rv2205cHelp
Entry
Rv2205c           CDS       T00015                                 

Definition
(RefSeq) hypothetical protein
  KO
K00865  glycerate 2-kinase [EC:2.7.1.165]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00561  Glycerolipid metabolism
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu01100  Metabolic pathways
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv2205c
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    Rv2205c
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv2205c
Enzymes [BR:mtu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     Rv2205c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gly_kinase
Motif
Other DBs
NCBI-GeneID: 887277
NCBI-ProteinID: NP_216721
TubercuList: Rv2205c
UniProt: P9WMT7
Position
complement(2469387..2470463)
Genome map
AA seq 358 aa AA seqDB search
MRVLVAPDCYGDSLSAVEAAAAIATGWTRSRPGDSFIVAPQSDGGPGFVEVLGSRLGETR
RLRVCGPLNTVVNAAWVFDPGSATAYLECAQACGLGLLGGPPTPETALAAHSKGVGQLIA
AALRAGAARIVVGLGGSACTDGGKGMIAELGGLDAARRQLADVEVIAASDVEYPLLGPWG
TARVFAPQKGADMATVAVLEGRLAAWAIELDAAAGRGVSAEPGAGAAGGIGAGLLAVGGR
YQSGAAIIAEHTHFADDLADAELIVTGEGRFDEQSLHGKVVGAIAAAARPLAIPVIVLAG
QVSLDKSALRSAGIMAALSIAEYAGSVRLALADAANQLMGLASQVAARLGNSGPSGYR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgttggtggcaccggactgctacggcgacagcctgtctgcggtggaggccgcc
gcggccattgcgaccggctggacgcggtcgcgaccaggcgattcgttcatcgtcgccccc
caatccgatggcggtccgggttttgttgaggtgctgggcagccggctaggagagacccgc
cggctgcgtgtttgcgggccactgaacaccgtcgtgaacgcggcgtgggtgttcgatccg
ggctcggcaaccgcgtatttggagtgtgcgcaggcttgtggtctggggttgcttggcggc
ccgcccacgcccgagaccgcgctggcggcccacagcaagggcgtcggccagctcatcgcc
gcggcactgcgggccggggcggctcggatcgtggtggggttggggggcagcgcatgtacc
gacggggggaaggggatgattgccgagcttggcggcctggacgcggcccgccgacagttg
gccgacgtcgaggtgatcgccgcctcggatgtcgaatacccattgctgggaccatggggc
acggccagggtgttcgcgccgcagaagggcgcggacatggccaccgtcgcagtgttggaa
ggccgtctggcggcatgggcgattgaactggacgcggccgccgggcgcggggtgagcgcc
gagccgggcgcgggcgccgccggtggtatcggggctgggctgctcgcggttggcggccgg
taccagtcgggtgcggcaatcatcgcagagcacacgcattttgccgacgaccttgccgat
gcggagctgatcgtcaccggtgagggccgattcgacgagcaatccctgcacgggaaggtg
gttggtgcgatcgcggctgcggcccgcccgctcgcaattccggtgatagtgttggccggc
caggtgtcgctggacaagtccgcgttgcggtcggcgggcattatggccgcattgtccatc
gctgagtacgccggttcggtgcggttggcgctggccgatgcggccaatcagctcatgggc
ttggcgtctcaggtagcggcgcgactcgggaatagcggtccttcagggtaccgttga

DBGET integrated database retrieval system