KEGG   Mycobacterium tuberculosis H37Rv: Rv2210cHelp
Entry
Rv2210c           CDS       T00015                                 

Gene name
ilvE
Definition
(RefSeq) branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00270  Cysteine and methionine metabolism
mtu00280  Valine, leucine and isoleucine degradation
mtu00290  Valine, leucine and isoleucine biosynthesis
mtu00770  Pantothenate and CoA biosynthesis
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01210  2-Oxocarboxylic acid metabolism
mtu01230  Biosynthesis of amino acids
Module
mtu_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
mtu_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
mtu_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Rv2210c (ilvE)
   00280 Valine, leucine and isoleucine degradation
    Rv2210c (ilvE)
   00290 Valine, leucine and isoleucine biosynthesis
    Rv2210c (ilvE)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Rv2210c (ilvE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mtu01007]
    Rv2210c (ilvE)
Enzymes [BR:mtu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     Rv2210c (ilvE)
Amino acid related enzymes [BR:mtu01007]
 Aminotransferase (transaminase)
  Class IV
   Rv2210c (ilvE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-GeneID: 888352
NCBI-ProteinID: NP_216726
TubercuList: Rv2210c
UniProt: P9WQ75 I6XDS7
Structure
PDB: 

Position
complement(2474864..2475970)
Genome map
AA seq 368 aa AA seqDB search
MTSGSLQFTVLRAVNPATDAQRESMLREPGFGKYHTDHMVSIDYAEGRGWHNARVIPYGP
IELDPSAIVLHYAQEVFEGLKAYRWADGSIVSFRADANAARLRSSARRLAIPELPDAVFI
ESLRQLIAVDKAWVPGAGGEEALYLRPFIFATEPGLGVRPATQYRYLLIASPAGAYFKGG
IAPVSVWVSTEYVRACPGGTGAAKFGGNYAASLLAQAEAAENGCDQVVWLDAVERRYIEE
MGGMNIFFVLGSGGSARLVTPELSGSLLPGITRDSLLQLAIDAGFAVEERRIDIDEWQKK
AAAGEITEVFACGTAAVITPVARVRHGASEFRIADGQPGEVTMALRDTLTGIQRGTFADT
HGWMARLG
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcggctcccttcaattcacggtgttacgtgcggtcaatccggccaccgacgcg
cagcgtgaatcgatgctgcgggagccgggtttcggcaaataccacaccgaccatatggtg
tcgatcgactatgccgagggccgtggttggcacaacgcgcgggtaatcccttatggcccg
atcgagctggatccctcggcgatcgtgctgcactatgcgcaggaggtgttcgaagggctc
aaagcctaccgctgggccgacgggtccatcgtgtcgtttcgcgccgacgccaacgccgcc
aggttgcgttcgtcggcgcggcggttggcgattcccgaactgcccgacgcggtgttcatc
gaatccctgcgccagctaatcgctgtcgacaaagcttgggtgcccggtgccggcggtgag
gaggcgctgtatctgcggccgttcatcttcgccaccgagccgggactgggcgtgcggcct
gccacccaataccgttacctgttgatcgcctcgccggccggtgcgtacttcaagggcggc
atcgcccctgtcagcgtctgggtttcgacggagtatgtacgggcctgtccgggcggcacc
ggtgcggccaagttcggcggcaactacgccgcctcgttgctggcgcaggccgaagccgcc
gagaacggatgcgaccaggtggtgtggctggacgctgtggaacgccgctatatcgaagag
atgggtggcatgaacatcttcttcgtgctcggcagcggcggatcggcgcggctggtcacc
ccggagctgtccggttccctgctgcccgggatcacacgggattcgttgttgcagttggct
attgatgccggattcgcggtcgaggaacgcaggattgatatcgacgagtggcagaagaaa
gccgccgccggcgagatcaccgaggtgtttgcgtgcggcaccgccgctgtcatcaccccg
gtcgcgcgggtgcggcacggtgccagcgagttcagaatcgccgacggtcagccgggtgag
gtgaccatggcactacgcgatacgctgaccggcatccagcggggcaccttcgcggacacc
cacggctggatggcgcggctggggtag

DBGET integrated database retrieval system