KEGG   Mycobacterium tuberculosis H37Rv: Rv2211cHelp
Entry
Rv2211c           CDS       T00015                                 

Gene name
gcvT
Definition
(RefSeq) aminomethyltransferase
  KO
K00605  aminomethyltransferase [EC:2.1.2.10]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00260  Glycine, serine and threonine metabolism
mtu00630  Glyoxylate and dicarboxylate metabolism
mtu00670  One carbon pool by folate
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rv2211c (gcvT)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Rv2211c (gcvT)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Rv2211c (gcvT)
Enzymes [BR:mtu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.10  aminomethyltransferase
     Rv2211c (gcvT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GCV_T GCV_T_C
Motif
Other DBs
NCBI-GeneID: 887233
NCBI-ProteinID: NP_216727
TubercuList: Rv2211c
UniProt: P9WN51
Position
complement(2476042..2477181)
Genome map
AA seq 379 aa AA seqDB search
MCQQGRPLGWDAVSDVPELIHGPLEDRHRELGASFAEFGGWLMPVSYAGTVSEHNATRTA
VGLFDVSHLGKALVRGPGAAQFVNSALTNDLGRIGPGKAQYTLCCTESGGVIDDLIAYYV
SDDEIFLVPNAANTAAVVGALQAAAPGGLSITNLHRSYAVLAVQGPCSTDVLTALGLPTE
MDYMGYADASYSGVPVRVCRTGYTGEHGYELLPPWESAGVVFDALLAAVSAAGGEPAGLG
ARDTLRTEMGYPLHGHELSLDISPLQARCGWAVGWRKDAFFGRAALLAEKAAGPRRLLRG
LRMVGRGVLRPGLAVLVGDETVGVTTSGTFSPTLQVGIGLALIDSDAGIEDGQQINVDVR
GRAVECQVVCPPFVAVKTR
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
gtgtgccagcagggacgcccattagggtgggacgccgtgagcgatgtgccagagctgata
cacggaccgctggaagaccgccatcgcgagctgggtgcgagtttcgccgagttcggcggc
tggctgatgccggtctcgtatgccggaaccgtcagcgagcacaacgccacccgcaccgcc
gtcggccttttcgacgtcagccacctgggcaaggcactggtccgtggaccgggtgcggcg
cagttcgtcaactccgcgctcaccaacgacctgggtcgtatcgggcccggcaaggcgcaa
tacaccttgtgctgcaccgaatccggcggtgtgatcgacgacctgatcgcctactacgtc
agcgacgacgagatctttctggtgcccaacgccgccaataccgccgcggtggtcggcgcg
ctacaagctgccgcaccgggcggtctgagcatcaccaatctgcatcggtcctacgcggtg
ctggccgtacaggggccgtgttcgaccgacgtgctcaccgcgttggggctgccaaccgag
atggactacatgggctacgccgacgcttcgtactcgggggtgccggtgcgtgtctgtcgc
accggctacaccggtgagcacggttacgaactgctgccgccatgggagtcggcgggtgtg
gtgttcgacgcactgttggcggcggtatcagccgcgggcggcgagcccgccggcctcggt
gctcgcgacacactgcgcactgaaatgggctatccgctgcacgggcacgagctttcgctg
gacatctcgccgctgcaggcccgatgcggctgggcggtcggctggcggaaggacgccttc
tttggtcgtgcggcgttgttggccgagaaagcggccgggccgcggcggctgctgcggggg
ctgcgcatggtcggtcgcggtgtgctgcgccccgggctggctgtgcttgtcggggatgag
acggttggggtcaccacgtcgggaacgttttctcccacgttgcaggtcggcatcgggctg
gcgctgatcgacagtgatgccggcatcgaagacggccagcaaatcaatgtcgacgtccgc
ggccgtgctgtcgaatgtcaagtggtgtgtccgccgttcgttgccgtgaaaacgcgctga

DBGET integrated database retrieval system