KEGG   Mycobacterium tuberculosis H37Rv: Rv2217Help
Entry
Rv2217            CDS       T00015                                 

Gene name
lipB
Definition
(RefSeq) octanoyltransferase
  KO
K03801  lipoyl(octanoyl) transferase [EC:2.3.1.181]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00785  Lipoic acid metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    Rv2217 (lipB)
Enzymes [BR:mtu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.181  lipoyl(octanoyl) transferase
     Rv2217 (lipB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPL_LplA_LipB Gp_dh_C
Motif
Other DBs
NCBI-GeneID: 887626
NCBI-ProteinID: NP_216733
TubercuList: Rv2217
UniProt: P9WK83 I6X3L9
Structure
PDB: 

Position
2484584..2485276
Genome map
AA seq 230 aa AA seqDB search
MTGSIRSKLSAIDVRQLGTVDYRTAWQLQRELADARVAGGADTLLLLEHPAVYTAGRRTE
THERPIDGTPVVDTDRGGKITWHGPGQLVGYPIIGLAEPLDVVNYVRRLEESLIQVCADL
GLHAGRVDGRSGVWLPGRPARKVAAIGVRVSRATTLHGFALNCDCDLAAFTAIVPCGISD
AAVTSLSAELGRTVTVDEVRATVAAAVCAALDGVLPVGDRVPSHAVPSPL
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
gtgacgggttctatccggtcgaagctgtccgcgatcgacgtccgccagctggggaccgtc
gactaccggaccgcgtggcagctacagcgagagctagccgacgcccgggtcgccggcggc
gccgacacgctgctgctgttggaacaccccgcggtctacaccgccggacggcgtaccgag
acacacgagcgacccattgacggcactccggtcgtcgacaccgaccgcggcggcaagatc
acctggcacggtccggggcaattggtcggctacccgatcatcgggctggccgaacccctc
gacgtggtcaattacgttcggcgccttgaagaatcgctgatccaagtctgcgccgatctg
ggcctgcacgccggccgcgtcgacggccggtccggggtctggctgcccggcaggccggcg
cgcaaggtcgcggccatcggtgtccgggtgtcgcgggcgacgacactgcacgggtttgcg
ctcaactgcgattgtgatttggctgccttcaccgccatcgtgccatgcggaatcagtgac
gccgcagtgacatcgctgtccgccgaactcggccgtacggtcaccgtcgacgaggtccgc
gcgacggtcgccgccgctgtctgcgccgctctggacggcgtcctaccggtcggtgaccgc
gtgccctcacacgccgtaccatcgccgttatga

DBGET integrated database retrieval system