KEGG   Mycobacterium tuberculosis H37Rv: Rv2218Help
Entry
Rv2218            CDS       T00015                                 

Gene name
lipA
Definition
(RefSeq) lipoyl synthase
  KO
K03644  lipoyl synthase [EC:2.8.1.8]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00785  Lipoic acid metabolism
mtu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    Rv2218 (lipA)
Enzymes [BR:mtu01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.8  lipoyl synthase
     Rv2218 (lipA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM LIAS_N
Motif
Other DBs
NCBI-GeneID: 887922
NCBI-ProteinID: NP_216734
TubercuList: Rv2218
UniProt: P9WK91 I6Y8Q8
Structure
PDB: 

Position
2485273..2486208
Genome map
AA seq 311 aa AA seqDB search
MSVAAEGRRLLRLEVRNAQTPIERKPPWIKTRARIGPEYTELKNLVRREGLHTVCEEAGC
PNIFECWEDREATFLIGGDQCTRRCDFCQIDTGKPAELDRDEPRRVADSVRTMGLRYATV
TGVARDDLPDGGAWLYAATVRAIKELNPSTGVELLIPDFNGEPTRLAEVFESGPEVLAHN
VETVPRIFKRIRPAFTYRRSLGVLTAARDAGLVTKSNLILGLGETSDEVRTALGDLRDAG
CDIVTITQYLRPSARHHPVERWVKPEEFVQFARFAEGLGFAGVLAGPLVRSSYRAGRLYE
QARNSRALASR
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtcgctgccgagggccggcgcctgttacgcctggaggtgcgcaacgcgcagacc
ccaatcgagcgcaaaccgccgtggatcaagacacgagcccgcatcgggccggagtacacc
gagctgaagaacctggtccgccgcgaggggctgcacacggtctgcgaggaggccggctgc
cccaacatcttcgaatgctgggaggaccgagaagccaccttcctgatcggcggtgaccag
tgcacccgccgatgcgatttctgccagatcgacaccggaaagcccgccgagctggaccgc
gacgagccacgccgagtcgccgacagcgtgcgcacgatgggcctgcgctatgccaccgtc
accggcgtggctcgcgacgacctgcctgacggcggggcctggctgtacgccgcgaccgtg
cgcgccatcaaggaactcaatccgtcgaccggcgtcgaactgctgattcccgacttcaac
ggcgaaccaacccggctggccgaggtcttcgagtccggcccggaagtcctggcacacaat
gtcgaaaccgtgccccgtatcttcaagcggatccggccggcgttcacgtaccggcgcagc
ctgggtgtgcttaccgctgcgcgcgacgccggcctggtcaccaagagcaacctcatcctc
ggcctgggcgaaacctccgacgaggtgcgcaccgccctgggcgatctgcgcgacgccggc
tgcgacatcgttaccatcacccaatacctgcggccgtcggcgcgccaccatccggtcgag
cgctgggtgaagcccgaggagttcgtccagttcgcgcgattcgccgaagggctgggcttc
gccggggtattggcgggacccctggttaggtcgtcatatcgggcgggccggctctacgaa
caggcacgtaactcacgggccttggcatcccgctag

DBGET integrated database retrieval system