KEGG   Mycobacterium tuberculosis H37Rv: Rv2231cHelp
Entry
Rv2231c           CDS       T00015                                 

Gene name
cobC
Definition
(RefSeq) aminotransferase
Organism
mtu  Mycobacterium tuberculosis H37Rv
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 888337
NCBI-ProteinID: NP_216747
TubercuList: Rv2231c
UniProt: P9WQ89
Position
complement(2504605..2505699)
Genome map
AA seq 364 aa AA seqDB search
MLWILGPHTGPLLFDAVASLDTSPLAAARYHGDQDVAPGVLDFAVNVRHDRPPEWLVRQL
AALLPELARYPSTDDVHRAQDAVAERHGRTRDEVLPLVGAAEGFALLHNLSPVRAAIVVP
AFTEPAIALSAAGITAHHVVLKPPFVLDTAHVPDDADLVVVGNPTNPTSVLHLREQLLEL
RRPGRILVVDEAFADWVPGEPQSLADDSLPDVLVLRSLTKTWSLAGLRVGYALGSPDVLA
RLTVQRAHWPLGTLQLTAIAACCAPRAVAAAAADAVRLTALRAEMVAGLRSVGAEVVDGA
APFVLFNIADADGLRNYLQSKGIAVRRGDTFVGLDARYLRAAVRPEWPVLVAAIAEWAKR
GGRR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
gtgctctggattcttggcccgcacaccggcccactactgtttgacgctgtggcgagtcta
gacactagcccgcttgccgcggcgcgctaccacggtgatcaggatgtcgcgcccggcgtg
ctggacttcgccgtcaacgtccgccatgaccggcccccggaatggttggtccggcagctc
gccgcgctgctgccggagctggcccgctatccgagcaccgacgatgtgcaccgggcgcaa
gacgcggtcgctgaacgtcatggcagaacccgtgacgaagtgctcccgctcgtcggggcg
gcggagggattcgcattgctgcacaacctaagtccggtgcgggcagcaatcgtcgtgccc
gcgttcaccgagccggccatagccttgagcgctgccggaatcacggcgcaccatgttgtc
ctaaagccgccgttcgtgctggacaccgcgcacgtgcctgacgacgccgaccttgtcgtc
gtgggtaatccgaccaaccccacctcggtgctgcacctccgcgagcagctgctcgagtta
cgccggccgggacgcatcctggtggtcgacgaggcgttcgctgattgggttcccggcgag
ccgcaatcgttggccgatgactcgctgcccgatgtgctggtgctccgtagcttgacgaaa
acgtggtcgctggccggattgcgggtgggctacgcgctcggctcgccagacgtgctggct
cggttgaccgtgcagcgagcgcactggccgttgggaacattgcaactgacggccatcgct
gcttgctgcgccccccgggcggtcgccgctgccgcagccgatgcggtgcggttgacggcg
ctgcgcgcggagatggtggccggactgagatcggtgggtgccgaggtggtcgatggtgcg
gcccctttcgtactgttcaacatcgccgatgctgacggattacgaaactatttgcagagc
aaaggaattgcggtgcgccgcggtgacaccttcgtcggcctggacgcgcggtacctgcgg
gcggcggtgcgcccggagtggcccgtgctggtggcggcgatcgccgagtgggcaaagcgt
ggaggacgccgatga

DBGET integrated database retrieval system