KEGG   Mycobacterium tuberculosis H37Rv: Rv2241Help
Entry
Rv2241            CDS       T00015                                 

Gene name
aceE
Definition
(RefSeq) pyruvate dehydrogenase E1 component
  KO
K00163  pyruvate dehydrogenase E1 component [EC:1.2.4.1]
Organism
mtu  Mycobacterium tuberculosis H37Rv
Pathway
mtu00010  Glycolysis / Gluconeogenesis
mtu00020  Citrate cycle (TCA cycle)
mtu00620  Pyruvate metabolism
mtu01100  Metabolic pathways
mtu01110  Biosynthesis of secondary metabolites
mtu01120  Microbial metabolism in diverse environments
mtu01130  Biosynthesis of antibiotics
mtu01200  Carbon metabolism
Module
mtu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mtu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Rv2241 (aceE)
   00020 Citrate cycle (TCA cycle)
    Rv2241 (aceE)
   00620 Pyruvate metabolism
    Rv2241 (aceE)
Enzymes [BR:mtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.1  pyruvate dehydrogenase (acetyl-transferring)
     Rv2241 (aceE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transketolase_C
Motif
Other DBs
NCBI-GeneID: 887246
NCBI-ProteinID: NP_216757
TubercuList: Rv2241
UniProt: P9WIS9
Position
2512539..2515244
Genome map
AA seq 901 aa AA seqDB search
MASYLPDIDPEETSEWLESFDTLLQRCGPSRARYLMLRLLERAGEQRVAIPALTSTDYVN
TIPTELEPWFPGDEDVERRYRAWIRWNAAIMVHRAQRPGVGVGGHISTYASSAALYEVGF
NHFFRGKSHPGGGDQVFIQGHASPGIYARAFLEGRLTAEQLDGFRQEHSHVGGGLPSYPH
PRLMPDFWEFPTVSMGLGPLNAIYQARFNHYLHDRGIKDTSDQHVWCFLGDGEMDEPESR
GLAHVGALEGLDNLTFVINCNLQRLDGPVRGNGKIIQELESFFRGAGWNVIKVVWGREWD
ALLHADRDGALVNLMNTTPDGDYQTYKANDGGYVRDHFFGRDPRTKALVENMSDQDIWNL
KRGGHDYRKVYAAYRAAVDHKGQPTVILAKTIKGYALGKHFEGRNATHQMKKLTLEDLKE
FRDTQRIPVSDAQLEENPYLPPYYHPGLNAPEIRYMLDRRRALGGFVPERRTKSKALTLP
GRDIYAPLKKGSGHQEVATTMATVRTFKEVLRDKQIGPRIVPIIPDEARTFGMDSWFPSL
KIYNRNGQLYTAVDADLMLAYKESEVGQILHEGINEAGSVGSFIAAGTSYATHNEPMIPI
YIFYSMFGFQRTGDSFWAAADQMARGFVLGATAGRTTLTGEGLQHADGHSLLLAATNPAV
VAYDPAFAYEIAYIVESGLARMCGENPENIFFYITVYNEPYVQPPEPENFDPEGVLRGIY
RYHAATEQRTNKAQILASGVAMPAALRAAQMLAAEWDVAADVWSVTSWGELNRDGVAIET
EKLRHPDRPAGVPYVTRALENARGPVIAVSDWMRAVPEQIRPWVPGTYLTLGTDGFGFSD
TRPAARRYFNTDAESQVVAVLEALAGDGEIDPSVPVAAARQYRIDDVAAAPEQTTDPGPG
A
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
gtggcgtcgtatttgcccgacattgatcccgaggagacctcggagtggctggagtccttt
gacacgctgctgcaacgctgcggcccgtcgcgggcccgctacctgatgttgcggctgcta
gagcgggccggcgagcagcgggtggccatcccggcattgacgtctaccgactatgtcaac
accatcccgaccgagctggagccgtggttccccggcgacgaagacgtcgaacgtcgttat
cgagcgtggatcagatggaatgcggccatcatggtgcaccgtgcgcaacgaccgggtgtg
ggcgtgggtggccatatctcgacctacgcgtcgtccgcggcgctctatgaggtcggtttc
aaccacttcttccgcggcaagtcgcacccgggcggcggcgatcaggtgttcatccagggc
cacgcttccccgggaatctacgcgcgcgccttcctcgaagggcggttgaccgccgagcaa
ctcgacggattccgccaggaacacagccatgtcggcggcgggttgccgtcctatccgcac
ccgcggctcatgcccgacttctgggaattccccaccgtgtcgatgggtttgggcccgctc
aacgccatctaccaggcacggttcaaccactatctgcatgaccgcggtatcaaagacacc
tccgatcaacacgtgtggtgttttttgggcgacggcgagatggacgaacccgagagccgt
gggctggcccacgtcggcgcgctggaaggcttggacaacttgaccttcgtgatcaactgc
aatctgcagcgactcgacggcccggtgcgcggcaacggcaagatcatccaggagctggag
tcgttcttccgcggtgccggctggaacgtcatcaaggtggtgtggggccgcgaatgggat
gccctgctgcacgccgaccgcgacggtgcgctggtgaatttaatgaatacaacacccgat
ggcgattaccagacctataaggccaacgacggcggctacgtgcgtgaccacttcttcggc
cgcgacccacgcaccaaggcgctggtggagaacatgagcgaccaggatatctggaacctc
aaacggggcggccacgattaccgcaaggtttacgccgcctaccgcgccgccgtcgaccac
aagggacagccgacggtgatcctggccaagaccatcaaaggctacgcgctgggcaagcat
ttcgaaggacgcaatgccacccaccagatgaaaaaactgaccctggaagaccttaaggag
tttcgtgacacgcagcggattccggtcagcgacgcccagcttgaagagaatccgtacctg
ccgccctactaccaccccggcctcaacgccccggagattcgttacatgctcgaccggcgc
cgggccctcgggggctttgttcccgagcgcaggaccaagtccaaagcgctgaccctgccg
ggtcgcgacatctacgcgccgctgaaaaagggctctgggcaccaggaggtggccaccacc
atggcgacggtgcgcacgttcaaagaagtgttgcgcgacaagcagatcgggccgcggata
gtcccgatcattcccgacgaggcccgcaccttcgggatggactcctggttcccgtcgcta
aagatctataaccgcaatggccagctgtataccgcggttgacgccgacctgatgctggcc
tacaaggagagcgaagtcgggcagatcctgcacgagggcatcaacgaagccgggtcggtg
ggctcgttcatcgcggccggcacctcgtatgcgacgcacaacgaaccgatgatccccatt
tacatcttctactcgatgttcggcttccagcgcaccggcgatagcttctgggccgcggcc
gaccagatggctcgagggttcgtgctcggggccaccgccgggcgcaccaccctgaccggt
gagggcctgcaacacgccgacggtcactcgttgctgctggccgccaccaacccggcggtg
gttgcctacgacccggccttcgcctacgaaatcgcctacatcgtggaaagcggactggcc
aggatgtgcggggagaacccggagaacatcttcttctacatcaccgtctacaacgagccg
tacgtgcagccgccggagccggagaacttcgatcccgagggcgtgctgcggggtatctac
cgctatcacgcggccaccgagcaacgcaccaacaaggcgcagatcctggcctccggggta
gcgatgcccgcggcgctgcgggcagcacagatgctggccgccgagtgggatgtcgccgcc
gacgtgtggtcggtgaccagttggggcgagctaaaccgcgacggggtggccatcgagacc
gagaagctccgccaccccgatcggccggcgggcgtgccctacgtgacgagagcgctggag
aatgctcggggcccggtgatcgcggtgtcggactggatgcgcgcggtccccgagcagatc
cgaccgtgggtgccgggcacatacctcacgttgggcaccgacgggttcggcttttccgac
actcggcccgccgctcgccgctacttcaacaccgacgccgaatcccaggtggtcgcggtt
ttggaggcgttggcgggcgacggcgagatcgacccatcggtgccggtcgcggccgcccgc
cagtaccggatcgacgacgtggcggctgcgcccgagcagaccacggatcccggtcccggg
gcctaa

DBGET integrated database retrieval system